Align Maltose-transporting ATPase (EC 3.6.3.19) (characterized)
to candidate WP_017219776.1 A923_RS0101025 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= reanno::psRCH2:GFF857 (371 letters) >NCBI__GCF_000276805.1:WP_017219776.1 Length = 360 Score = 300 bits (767), Expect = 5e-86 Identities = 159/357 (44%), Positives = 227/357 (63%), Gaps = 13/357 (3%) Query: 4 VTLRDICKSYD-GTPITRHIDLDIEDGEFVVFVGPSGCGKSTLLRLIAGLEDITSGDLLI 62 + L+++ K+Y+ G + + +DI+ GEF+V VGPSGCGKS++LR IAGLE IT G++ + Sbjct: 2 LALKNLVKTYENGHQAVKGVSVDIKQGEFIVLVGPSGCGKSSILRSIAGLESITGGEIHL 61 Query: 63 DNQRVNDLPPKDRSVGMVFQSYALYPHMTVAENMAFGLKLASVDKREIKRRVEAVAEILQ 122 +N+R+++ P R + MVFQ+YALYPHMTV EN+A+GLK +D+ I+ ++E VA+ L+ Sbjct: 62 NNRRIDNEKPASRDIAMVFQNYALYPHMTVYENLAYGLKNRGIDRDTIESKIEKVAKTLK 121 Query: 123 LDKLLERKPKDLSGGQRQRVAIGRTMVREPKVFLFDEPLSNLDAFLRVQMRIEIARLHQR 182 + LERKP LSGGQRQRVA+GR +VR+P++FLFDEPLSNLDA LR MR+EI +L + Sbjct: 122 IADYLERKPAKLSGGQRQRVAMGRAIVRDPQLFLFDEPLSNLDASLRAHMRLEIKKLQRE 181 Query: 183 IRSTMIYVTHDQVEAMTLADKIVVLNAGEIAQVGQPLHLYHYPKNRFVAGFLGSPQMNFV 242 + T +YVTHDQVEAMTLAD+I+VLN GEI Q+G P +YH P + FVA F+GSP MNF Sbjct: 182 LAVTSVYVTHDQVEAMTLADRIIVLNQGEIEQIGTPAEVYHQPASTFVASFIGSPAMNFH 241 Query: 243 EVRAISASPETVTIELPSGYPLTLPVDGSAVSPGDPLTLGIRPEHFVM-PDEADFTFHGQ 301 + + E S + + A + LGIRPEH V+ P ++ +F Sbjct: 242 QAEIADG---VINFEHQSIF-----IAEYAHLSAQTIQLGIRPEHAVLEPSKSGLSFSLT 293 Query: 302 ITVAERLGQYNLLYLTLERLQDVITLCVDGNLRVTEGETFAAGLKADKCHLFRENGE 358 + E LG L++ + D + + L + + HLF +NG+ Sbjct: 294 VQAVEPLGPNQLVH---GLVNDKVFTALTPELHFASKQVLTLHVAKQHLHLFDKNGQ 347 Lambda K H 0.322 0.139 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 370 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 371 Length of database: 360 Length adjustment: 30 Effective length of query: 341 Effective length of database: 330 Effective search space: 112530 Effective search space used: 112530 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory