Align ABC-type maltose transporter (EC 7.5.2.1) (characterized)
to candidate WP_017219776.1 A923_RS0101025 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= BRENDA::Q70HW1 (384 letters) >NCBI__GCF_000276805.1:WP_017219776.1 Length = 360 Score = 296 bits (759), Expect = 5e-85 Identities = 168/357 (47%), Positives = 223/357 (62%), Gaps = 17/357 (4%) Query: 6 LEHIYKTYPGQTEPTVKDFNLDIQDKEFTVFVGPSGCGKTTTLRMIAGLEDITEGNLYIG 65 L+++ KTY + VK ++DI+ EF V VGPSGCGK++ LR IAGLE IT G +++ Sbjct: 4 LKNLVKTYENGHQ-AVKGVSVDIKQGEFIVLVGPSGCGKSSILRSIAGLESITGGEIHLN 62 Query: 66 DRRVNDVPPKDRDIAMVFQNYALYPHMTVYQNMAFGLKLRKVPKAEIDRRVQEAAKILDI 125 +RR+++ P RDIAMVFQNYALYPHMTVY+N+A+GLK R + + I+ ++++ AK L I Sbjct: 63 NRRIDNEKPASRDIAMVFQNYALYPHMTVYENLAYGLKNRGIDRDTIESKIEKVAKTLKI 122 Query: 126 AHLLDRKPKALSGGQRQRVALGRAIVREPQVFLMDEPLSNLDAKLRVQMRAEIRKLHQRL 185 A L+RKP LSGGQRQRVA+GRAIVR+PQ+FL DEPLSNLDA LR MR EI+KL + L Sbjct: 123 ADYLERKPAKLSGGQRQRVAMGRAIVRDPQLFLFDEPLSNLDASLRAHMRLEIKKLQREL 182 Query: 186 QTTVIYVTHDQTEAMTMGDRIVVMRDGVIQQADTPQVVYSQPKNMFVAGFIGSPAMNFIR 245 T +YVTHDQ EAMT+ DRI+V+ G I+Q TP VY QP + FVA FIGSPAMNF + Sbjct: 183 AVTSVYVTHDQVEAMTLADRIIVLNQGEIEQIGTPAEVYHQPASTFVASFIGSPAMNFHQ 242 Query: 246 GEIVQDGDAFYFRAPSISLRLPEGRYGVLKASGAIGKPVVLGVRPEDLHDEEVFMTTYPD 305 EI DG F SI + Y L A + + LG+RPE V + Sbjct: 243 AEIA-DG-VINFEHQSIFI----AEYAHLSA-----QTIQLGIRPE----HAVLEPSKSG 287 Query: 306 SVLQMQVEVVEHMGSEVYLHTSIGPNTIVARVNPRHVYHVGSSVKLAIDLNKIHIFD 362 + V+ VE +G +H + A + P + + L + +H+FD Sbjct: 288 LSFSLTVQAVEPLGPNQLVHGLVNDKVFTA-LTPELHFASKQVLTLHVAKQHLHLFD 343 Lambda K H 0.321 0.138 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 375 Number of extensions: 15 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 384 Length of database: 360 Length adjustment: 30 Effective length of query: 354 Effective length of database: 330 Effective search space: 116820 Effective search space used: 116820 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory