Align Mannitol-specific phosphotransferase enzyme IIA component (characterized, see rationale)
to candidate WP_017223100.1 A923_RS0118070 fused PTS fructose transporter subunit IIA/HPr protein
Query= uniprot:Q45420 (145 letters) >NCBI__GCF_000276805.1:WP_017223100.1 Length = 385 Score = 106 bits (264), Expect = 4e-28 Identities = 57/136 (41%), Positives = 78/136 (57%) Query: 6 LKKENIVLHARVENKTEAIRLAGQILVNNGYVEDSYIDKMFEREALTSTYMGNFIAIPHG 65 L +I L NK AI+ Q L N YVE SY+D M REA STY+GN IAIPHG Sbjct: 4 LSTNDIQLKQSASNKQHAIKALAQSLANKTYVEASYVDGMLAREAQHSTYLGNGIAIPHG 63 Query: 66 TEDAKQFVKHSGISIIQIPDGVDFGDGNIVKLLIGIAGKNNEHLEILSKIAIVCSEVENV 125 T D + V +G+ + P GVD+G+G +V L I IA K++EHL IL ++ V S Sbjct: 64 TVDTRDLVNKTGVQLHHYPQGVDWGEGQVVYLAIAIAAKSDEHLAILKQLTHVLSADGIE 123 Query: 126 ETMIKAATEEEILSIL 141 + + + E I+++L Sbjct: 124 QQLQDCDSAEAIIAVL 139 Lambda K H 0.316 0.135 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 122 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 145 Length of database: 385 Length adjustment: 23 Effective length of query: 122 Effective length of database: 362 Effective search space: 44164 Effective search space used: 44164 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory