Align ABC transporter for D-Mannitol, D-Mannose, and D-Mannose, ATPase component (characterized)
to candidate WP_017219776.1 A923_RS0101025 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= reanno::pseudo13_GW456_L13:PfGW456L13_3039 (367 letters) >NCBI__GCF_000276805.1:WP_017219776.1 Length = 360 Score = 317 bits (811), Expect = 4e-91 Identities = 176/365 (48%), Positives = 240/365 (65%), Gaps = 26/365 (7%) Query: 4 LKIKNLQKGFE-GFSIIKGIDLEVNDKEFVVFVGPSGCGKSTLLRLIAGLEEVSGGTIEL 62 L +KNL K +E G +KG+ +++ EF+V VGPSGCGKS++LR IAGLE ++GG I L Sbjct: 2 LALKNLVKTYENGHQAVKGVSVDIKQGEFIVLVGPSGCGKSSILRSIAGLESITGGEIHL 61 Query: 63 DGRDITEVSPAKRDLAMVFQTYALYPHMSVRKNMSFALDLAGVAKAEVEKKVSEAARILE 122 + R I PA RD+AMVFQ YALYPHM+V +N+++ L G+ + +E K+ + A+ L+ Sbjct: 62 NNRRIDNEKPASRDIAMVFQNYALYPHMTVYENLAYGLKNRGIDRDTIESKIEKVAKTLK 121 Query: 123 LGPMLERKPKQLSGGQRQRVAIGRAIVRNPKIFLFDEPLSNLDAALRVQMRLELLRLHKE 182 + LERKP +LSGGQRQRVA+GRAIVR+P++FLFDEPLSNLDA+LR MRLE+ +L +E Sbjct: 122 IADYLERKPAKLSGGQRQRVAMGRAIVRDPQLFLFDEPLSNLDASLRAHMRLEIKKLQRE 181 Query: 183 LQATMIYVTHDQVEAMTMADKVVVLNGGKIEQVGSPLDLYHQPANLFVAGFLGTPKMGFL 242 L T +YVTHDQVEAMT+AD+++VLN G+IEQ+G+P ++YHQPA+ FVA F+G+P M F Sbjct: 182 LAVTSVYVTHDQVEAMTLADRIIVLNQGEIEQIGTPAEVYHQPASTFVASFIGSPAMNFH 241 Query: 243 KGKIT----RVDSQGCEVQLDAGTRVSLPLGGRHLSVGSAVTLGIRPEH--LELAKPGDC 296 + +I + Q + A HLS + LGIRPEH LE +K G Sbjct: 242 QAEIADGVINFEHQSIFIAEYA-----------HLS-AQTIQLGIRPEHAVLEPSKSG-L 288 Query: 297 ALQVTADVSERLGSDTFCH--VRTASGEALTMRVRGDLASRYGETLSLHLDAQHCHLFDA 354 + +T E LG + H V ALT + AS+ + L+LH+ QH HLFD Sbjct: 289 SFSLTVQAVEPLGPNQLVHGLVNDKVFTALTPELH--FASK--QVLTLHVAKQHLHLFDK 344 Query: 355 DGVAL 359 +G L Sbjct: 345 NGQRL 349 Lambda K H 0.320 0.137 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 370 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 367 Length of database: 360 Length adjustment: 29 Effective length of query: 338 Effective length of database: 331 Effective search space: 111878 Effective search space used: 111878 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory