Align TM1748, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized)
to candidate WP_017221112.1 A923_RS0107815 oligopeptide ABC transporter permease OppC
Query= TCDB::Q9X270 (289 letters) >NCBI__GCF_000276805.1:WP_017221112.1 Length = 300 Score = 215 bits (547), Expect = 1e-60 Identities = 113/279 (40%), Positives = 167/279 (59%), Gaps = 2/279 (0%) Query: 8 ESIGYWKAFWLRFKKNKMAVIGGVFVLILIALAIL-APYIAPYPYDEPHYIRAFEGPSKD 66 E W+ +RF +NK A++ +F+L LI L+++ P + Y +D+ + PS D Sbjct: 21 EGRSLWQDARIRFMRNKAAMVS-LFILFLITLSVIFVPMFSQYAFDDTDWYAMHAPPSVD 79 Query: 67 FIFGTDALGRDLFSRILYSLRNACIIGFGSQFVVLIIGGILGAVAGFKGGWIDKFIMSIV 126 FGTD+LGRDLF R R + ++G FV ++IG + GA +GF GG D+ +M I+ Sbjct: 80 HWFGTDSLGRDLFVRTFIGGRISMMVGVMGAFVAVLIGTLYGAASGFIGGKTDRVMMRIL 139 Query: 127 DIMFAFPTFLFNVILVTALGRGLFTIFLAIGLTGWAGMARLVRGQVLYLKNSEFVEAAKA 186 +I++A P ++LVT GR + IF+AIG W MAR+VRGQ L L+ EF+EAA Sbjct: 140 EILYAIPFMFLVIVLVTFFGRDIILIFVAIGAIAWLDMARIVRGQTLSLRGKEFIEAAHV 199 Query: 187 AGASTFYIIRKHILPNMIGPILVNLAFGVPGAMMTESGLAVIGMGVRPPMPSWGNLIGEG 246 G S + II +HI+PN++G + V +P ++TES L+ +G+GV+ PM SWG L+ EG Sbjct: 200 CGVSKWGIITRHIVPNVLGIVAVYSTLLIPSMILTESFLSFLGLGVQEPMTSWGALLQEG 259 Query: 247 IGMMMAFPHLLIFPAVTFAFTLISFTFLADGLRDAFNPR 285 M L FPA+ TL F ++ DGLRDA +P+ Sbjct: 260 AQTMELAIWQLGFPALFMVVTLFCFNYVGDGLRDALDPK 298 Lambda K H 0.331 0.147 0.457 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 248 Number of extensions: 6 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 289 Length of database: 300 Length adjustment: 26 Effective length of query: 263 Effective length of database: 274 Effective search space: 72062 Effective search space used: 72062 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory