Align spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 (characterized)
to candidate WP_017219776.1 A923_RS0101025 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= CharProtDB::CH_024626 (378 letters) >NCBI__GCF_000276805.1:WP_017219776.1 Length = 360 Score = 221 bits (564), Expect = 2e-62 Identities = 117/277 (42%), Positives = 177/277 (63%), Gaps = 9/277 (3%) Query: 28 DGKEVIPQLDLTINNGEFLTLLGPSGCGKTTVLRLIAGLETVDSGRIMLDNEDITHVPAE 87 +G + + + + I GEF+ L+GPSGCGK+++LR IAGLE++ G I L+N I + Sbjct: 13 NGHQAVKGVSVDIKQGEFIVLVGPSGCGKSSILRSIAGLESITGGEIHLNNRRIDNEKPA 72 Query: 88 NRYVNTVFQSYALFPHMTVFENVAFGLRMQKTPAAEITPRVMEALRMVQLETFAQRKPHQ 147 +R + VFQ+YAL+PHMTV+EN+A+GL+ + I ++ + + +++ + +RKP + Sbjct: 73 SRDIAMVFQNYALYPHMTVYENLAYGLKNRGIDRDTIESKIEKVAKTLKIADYLERKPAK 132 Query: 148 LSGGQQQRVAIARAVVNKPRLLLLDESLSALDYKLRKQMQNELKALQRKLGITFVFVTHD 207 LSGGQ+QRVA+ RA+V P+L L DE LS LD LR M+ E+K LQR+L +T V+VTHD Sbjct: 133 LSGGQRQRVAMGRAIVRDPQLFLFDEPLSNLDASLRAHMRLEIKKLQRELAVTSVYVTHD 192 Query: 208 QEEALTMSDRIVVMRDGRIEQDGTPREIYEEPKNLFVAGFIGE--INMFNATVIERLDEQ 265 Q EA+T++DRI+V+ G IEQ GTP E+Y +P + FVA FIG +N A + + + Sbjct: 193 QVEAMTLADRIIVLNQGEIEQIGTPAEVYHQPASTFVASFIGSPAMNFHQAEIADGV--- 249 Query: 266 RVRANVEGRECNIYVNFAVEPGQKLHVLLRPEDLRVE 302 N E + I +A Q + + +RPE +E Sbjct: 250 ---INFEHQSIFI-AEYAHLSAQTIQLGIRPEHAVLE 282 Lambda K H 0.319 0.136 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 343 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 378 Length of database: 360 Length adjustment: 30 Effective length of query: 348 Effective length of database: 330 Effective search space: 114840 Effective search space used: 114840 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory