Align Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale)
to candidate WP_017219776.1 A923_RS0101025 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= uniprot:A8LLL2 (373 letters) >NCBI__GCF_000276805.1:WP_017219776.1 Length = 360 Score = 265 bits (676), Expect = 2e-75 Identities = 148/314 (47%), Positives = 201/314 (64%), Gaps = 9/314 (2%) Query: 4 LKLTGVEKAYGDV-KVLSNINLDIQQGELIVFVGPSGCGKSTLLRMIAGLEKITGGTLEI 62 L L + K Y + + + +++DI+QGE IV VGPSGCGKS++LR IAGLE ITGG + + Sbjct: 2 LALKNLVKTYENGHQAVKGVSVDIKQGEFIVLVGPSGCGKSSILRSIAGLESITGGEIHL 61 Query: 63 DGTVVNDVPPAQRGIAMVFQSYALYPHMTVRENMSFALKIAKKSQAEIDAAVEAAAEKLQ 122 + +++ PA R IAMVFQ+YALYPHMTV EN+++ LK + I++ +E A+ L+ Sbjct: 62 NNRRIDNEKPASRDIAMVFQNYALYPHMTVYENLAYGLKNRGIDRDTIESKIEKVAKTLK 121 Query: 123 LGQYLDRLPKALSGGQRQRVAIGRSIVRDPKVYLFDEPLSNLDAALRVATRLEIAQLKEA 182 + YL+R P LSGGQRQRVA+GR+IVRDP+++LFDEPLSNLDA+LR RLEI +L+ Sbjct: 122 IADYLERKPAKLSGGQRQRVAMGRAIVRDPQLFLFDEPLSNLDASLRAHMRLEIKKLQRE 181 Query: 183 MPESTMVYVTHDQVEAMTLATRIVVLAGGGIAQVGSPLELYEKPENEFVAQFIGSPKMNL 242 + T VYVTHDQVEAMTLA RI+VL G I Q+G+P E+Y +P + FVA FIGSP MN Sbjct: 182 L-AVTSVYVTHDQVEAMTLADRIIVLNQGEIEQIGTPAEVYHQPASTFVASFIGSPAMNF 240 Query: 243 LPGKIIGTGAQTTVEMTDGGRAVSDYPSDDSLMGAAVNVGVRPEDMVEAAPGGDYVFEGK 302 +I A + +++Y L + +G+RPE V F Sbjct: 241 HQAEI----ADGVINFEHQSIFIAEYA---HLSAQTIQLGIRPEHAVLEPSKSGLSFSLT 293 Query: 303 VAITEALGEVTLLY 316 V E LG L++ Sbjct: 294 VQAVEPLGPNQLVH 307 Lambda K H 0.316 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 368 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 373 Length of database: 360 Length adjustment: 30 Effective length of query: 343 Effective length of database: 330 Effective search space: 113190 Effective search space used: 113190 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory