Align NAD(P)+ L-lactaldehyde dehydrogenase (EC 1.2.1.22) (characterized)
to candidate WP_017223668.1 A923_RS0121055 aldehyde dehydrogenase family protein
Query= metacyc::MONOMER-16244 (495 letters) >NCBI__GCF_000276805.1:WP_017223668.1 Length = 443 Score = 178 bits (452), Expect = 3e-49 Identities = 136/453 (30%), Positives = 213/453 (47%), Gaps = 14/453 (3%) Query: 37 TFGTVSPSTEEEITQVYEAFSEDIDDAVEAATAAFHSSWSTSDPQVRMKVLYKLADLIDE 96 T + P + I V +E + V AA A W+ +R + L + Sbjct: 3 TLTSYEPISRAAIGTVNITTAEQLPTLVNAAQQA-QQYWAKLSLGMRQQQLNHAFQQLTP 61 Query: 97 HADTLAHIEALDNGKSLMCSKGDVALTAAYFRSCAGWTDKIKGSVIETGDTHFNYTRREP 156 D LA + + GK + +V T +S + +TD+I ++ + P Sbjct: 62 VQDQLAKLIGQEMGKDYRRATYEVGGTV---QSASYFTDEISQALAPERLDRNTELQYRP 118 Query: 157 IGVCGQIIPWNFPLLMASWKLGPVLCTGCTTVLKTAESTPLSALYLASLIKEAGAPPGVV 216 +G+ I PWN+PL MA+ L P L G +LK +E TPL A + + + P G++ Sbjct: 119 LGIVAVIAPWNYPLAMANNLLMPALMAGNAVILKPSEETPLVAELFVNTLNKV-LPKGLL 177 Query: 217 NVVSGFGPTAGAPISSHPKIKKVAFTGSTATGRHIMKAAAESNLKKVTLELGGKSPNIVF 276 + G G T A ++S I VAFTGS ATG+HIM AA + LK++ +ELGG P IV Sbjct: 178 QLAQGDGETGKALVAS--AIHMVAFTGSMATGKHIMANAAPA-LKRLVMELGGNDPMIVM 234 Query: 277 DDADVKSTIQHLVTGIFYNTGEVCCAGSRIYVQEGIYDKIVSEFKNAAESLKIGDPFKED 336 AD+ + +Q V F N G++C + R+YV I + + A ++G K Sbjct: 235 ASADIDAAVQFAVASSFENAGQMCTSTERVYVDARIATEFERKVVALARQYQVGAWDKPR 294 Query: 337 TFMGAQTSQLQLDKILKYIDIGKKEGATVITGGERFGNKGYFIKPTIFGDVKEDHQIVRD 396 +G + +Q K+L + ++GA ++ G + + FI+PT+ + D + D Sbjct: 295 VNIGPLVNPVQHQKVLDQLQDATQKGAQLLLGRDDYPLP--FIQPTVVTGMTADMTLECD 352 Query: 397 EIFGPVVTITKFKTVEEVIALANDSEYGLAAGVHTTNLSTAISVSNKINSGTIWVNTYND 456 E FGPVV I+ FK ++E I ANDS YGL A V A +V+ ++ +G + +N Sbjct: 353 ETFGPVVAISHFKHIDEAILRANDSPYGLGAVVF--GGQGAAAVAEQLEAGMVGIN--QG 408 Query: 457 FHPMVPFGGYSQSGIGREMGEEALDNYTQVKAV 489 P+ G QSG G + QV+ V Sbjct: 409 VGGGGPWVGAKQSGFGFHGTAAGHRQFAQVRVV 441 Lambda K H 0.316 0.133 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 479 Number of extensions: 22 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 495 Length of database: 443 Length adjustment: 33 Effective length of query: 462 Effective length of database: 410 Effective search space: 189420 Effective search space used: 189420 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory