Align ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized)
to candidate WP_017219776.1 A923_RS0101025 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= reanno::Smeli:SMc03065 (362 letters) >NCBI__GCF_000276805.1:WP_017219776.1 Length = 360 Score = 304 bits (779), Expect = 2e-87 Identities = 170/361 (47%), Positives = 234/361 (64%), Gaps = 13/361 (3%) Query: 4 LLLKDIRKSY-GAVDVIHGIDLDIKEGEFVVFVGPSGCGKSTLLRMIAGLEEITGGDMFI 62 L LK++ K+Y + G+ +DIK+GEF+V VGPSGCGKS++LR IAGLE ITGG++ + Sbjct: 2 LALKNLVKTYENGHQAVKGVSVDIKQGEFIVLVGPSGCGKSSILRSIAGLESITGGEIHL 61 Query: 63 DGERVNDVPPSKRGIAMVFQSYALYPHMTVYDNMAFGMRIARESKEEIDRRVRGAADMLQ 122 + R+++ P+ R IAMVFQ+YALYPHMTVY+N+A+G++ ++ I+ ++ A L+ Sbjct: 62 NNRRIDNEKPASRDIAMVFQNYALYPHMTVYENLAYGLKNRGIDRDTIESKIEKVAKTLK 121 Query: 123 LTPYLDRLPKALSGGQRQRVAIGRAICRNPKVFLFDEPLSNLDAALRVATRIEIAKLSER 182 + YL+R P LSGGQRQRVA+GRAI R+P++FLFDEPLSNLDA+LR R+EI KL Sbjct: 122 IADYLERKPAKLSGGQRQRVAMGRAIVRDPQLFLFDEPLSNLDASLRAHMRLEIKKLQRE 181 Query: 183 MSDTTMIYVTHDQVEAMTLADRIVVLSAGHIEQVGAPLELYERPANLFVARFIGSPAMNV 242 ++ T +YVTHDQVEAMTLADRI+VL+ G IEQ+G P E+Y +PA+ FVA FIGSPAMN Sbjct: 182 LA-VTSVYVTHDQVEAMTLADRIIVLNQGEIEQIGTPAEVYHQPASTFVASFIGSPAMNF 240 Query: 243 IPATITATGQQTAVSLAGGKSVTLDVPTNASENGKTASFGVRPEDLRVTEADDFL-FEGT 301 A I A + + ++ + A + +T G+RPE + + L F T Sbjct: 241 HQAEI-------ADGVINFEHQSIFIAEYAHLSAQTIQLGIRPEHAVLEPSKSGLSFSLT 293 Query: 302 VSIVEALGEVTLLYIEGLVENEPIIAKMPGIARVGRGDKVRFTADKAKLHLFDTNGQSYR 361 V VE LG L + GLV ++ A P + + + K LHLFD NGQ + Sbjct: 294 VQAVEPLGPNQL--VHGLVNDKVFTALTPELHFASK-QVLTLHVAKQHLHLFDKNGQRLQ 350 Query: 362 A 362 A Sbjct: 351 A 351 Lambda K H 0.320 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 341 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 360 Length adjustment: 29 Effective length of query: 333 Effective length of database: 331 Effective search space: 110223 Effective search space used: 110223 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory