GapMind for catabolism of small carbon sources

 

Protein WP_019386474.1 in Arenitalea lutea P7-3-5

Annotation: NCBI__GCF_000283015.1:WP_019386474.1

Length: 282 amino acids

Source: GCF_000283015.1 in NCBI

Candidate for 55 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-histidine catabolism Ac3H11_2560 med ABC transporter for L-Histidine, ATPase component (characterized) 41% 86% 177.9 ABC transporter for nitrate, ATPase component 57% 302.4
N-acetyl-D-glucosamine catabolism SMc02869 lo N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 40% 67% 161.4 ABC transporter for nitrate, ATPase component 57% 302.4
D-glucosamine (chitosamine) catabolism SMc02869 lo N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 40% 67% 161.4 ABC transporter for nitrate, ATPase component 57% 302.4
D-maltose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 38% 63% 146.7 ABC transporter for nitrate, ATPase component 57% 302.4
D-maltose catabolism thuK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 38% 63% 146.7 ABC transporter for nitrate, ATPase component 57% 302.4
sucrose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 38% 63% 146.7 ABC transporter for nitrate, ATPase component 57% 302.4
trehalose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 38% 63% 146.7 ABC transporter for nitrate, ATPase component 57% 302.4
D-maltose catabolism malK lo ABC-type maltose transporter (subunit 3/3) (EC 7.5.2.1) (characterized) 39% 61% 146 ABC transporter for nitrate, ATPase component 57% 302.4
L-histidine catabolism hutV lo HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized) 36% 97% 145.2 ABC transporter for nitrate, ATPase component 57% 302.4
L-proline catabolism hutV lo HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized) 36% 97% 145.2 ABC transporter for nitrate, ATPase component 57% 302.4
sucrose catabolism thuK lo ThuK aka RB0314 aka SMB20328, component of Trehalose/maltose/sucrose porter (trehalose inducible) (characterized) 38% 67% 144.4 ABC transporter for nitrate, ATPase component 57% 302.4
trehalose catabolism thuK lo ThuK aka RB0314 aka SMB20328, component of Trehalose/maltose/sucrose porter (trehalose inducible) (characterized) 38% 67% 144.4 ABC transporter for nitrate, ATPase component 57% 302.4
D-cellobiose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 37% 55% 144.1 ABC transporter for nitrate, ATPase component 57% 302.4
D-glucose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 37% 55% 144.1 ABC transporter for nitrate, ATPase component 57% 302.4
lactose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 37% 55% 144.1 ABC transporter for nitrate, ATPase component 57% 302.4
D-maltose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 37% 55% 144.1 ABC transporter for nitrate, ATPase component 57% 302.4
sucrose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 37% 55% 144.1 ABC transporter for nitrate, ATPase component 57% 302.4
trehalose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 37% 55% 144.1 ABC transporter for nitrate, ATPase component 57% 302.4
D-xylose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 37% 55% 144.1 ABC transporter for nitrate, ATPase component 57% 302.4
L-proline catabolism proV lo glycine betaine/l-proline transport atp-binding protein prov (characterized) 34% 62% 143.7 ABC transporter for nitrate, ATPase component 57% 302.4
putrescine catabolism potA lo Spermidine/putrescine import ATP-binding protein PotA, component of The spermidine/putrescine uptake porter, PotABCD (characterized) 37% 54% 142.9 ABC transporter for nitrate, ATPase component 57% 302.4
D-sorbitol (glucitol) catabolism mtlK lo ABC transporter for D-Sorbitol, ATPase component (characterized) 35% 65% 142.1 ABC transporter for nitrate, ATPase component 57% 302.4
D-cellobiose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 38% 61% 140.2 ABC transporter for nitrate, ATPase component 57% 302.4
D-glucose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 38% 61% 140.2 ABC transporter for nitrate, ATPase component 57% 302.4
lactose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 38% 61% 140.2 ABC transporter for nitrate, ATPase component 57% 302.4
D-maltose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 38% 61% 140.2 ABC transporter for nitrate, ATPase component 57% 302.4
D-maltose catabolism malK1 lo MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 34% 60% 140.2 ABC transporter for nitrate, ATPase component 57% 302.4
sucrose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 38% 61% 140.2 ABC transporter for nitrate, ATPase component 57% 302.4
trehalose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 38% 61% 140.2 ABC transporter for nitrate, ATPase component 57% 302.4
D-maltose catabolism malK_Aa lo ABC-type maltose transporter (EC 7.5.2.1) (characterized) 38% 55% 139 ABC transporter for nitrate, ATPase component 57% 302.4
D-mannitol catabolism mtlK lo SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter (characterized) 35% 65% 138.7 ABC transporter for nitrate, ATPase component 57% 302.4
lactose catabolism lacK lo LacK, component of Lactose porter (characterized) 36% 58% 138.3 ABC transporter for nitrate, ATPase component 57% 302.4
D-glucosamine (chitosamine) catabolism SM_b21216 lo ABC transporter for D-Glucosamine, ATPase component (characterized) 34% 58% 137.5 ABC transporter for nitrate, ATPase component 57% 302.4
D-maltose catabolism malK_Sm lo MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 36% 57% 136.7 ABC transporter for nitrate, ATPase component 57% 302.4
trehalose catabolism malK lo MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 36% 57% 136.7 ABC transporter for nitrate, ATPase component 57% 302.4
L-fucose catabolism SM_b21106 lo ABC transporter for L-Fucose, ATPase component (characterized) 35% 62% 136.3 ABC transporter for nitrate, ATPase component 57% 302.4
D-cellobiose catabolism SMc04256 lo ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized) 36% 58% 135.2 ABC transporter for nitrate, ATPase component 57% 302.4
L-proline catabolism opuBA lo BusAA, component of Uptake system for glycine-betaine (high affinity) and proline (low affinity) (OpuAA-OpuABC) or BusAA-ABC of Lactococcus lactis). BusAA, the ATPase subunit, has a C-terminal tandem cystathionine β-synthase (CBS) domain which is the cytoplasmic K+ sensor for osmotic stress (osmotic strength)while the BusABC subunit has the membrane and receptor domains fused to each other (Biemans-Oldehinkel et al., 2006; Mahmood et al., 2006; Gul et al. 2012). An N-terminal amphipathic α-helix of OpuA is necessary for high activity but is not critical for biogenesis or the ionic regulation of transport (characterized) 32% 71% 135.2 ABC transporter for nitrate, ATPase component 57% 302.4
D-galactose catabolism PfGW456L13_1897 lo ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 35% 55% 134.8 ABC transporter for nitrate, ATPase component 57% 302.4
D-maltose catabolism malK_Bb lo ABC-type maltose transport, ATP binding protein (characterized, see rationale) 34% 65% 134.8 ABC transporter for nitrate, ATPase component 57% 302.4
L-arabinose catabolism xacJ lo Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale) 32% 58% 129.8 ABC transporter for nitrate, ATPase component 57% 302.4
D-maltose catabolism musK lo ABC-type maltose transporter (EC 7.5.2.1) (characterized) 36% 56% 129.8 ABC transporter for nitrate, ATPase component 57% 302.4
L-arabinose catabolism xacK lo Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale) 33% 58% 126.7 ABC transporter for nitrate, ATPase component 57% 302.4
D-mannose catabolism TT_C0211 lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 33% 56% 126.7 ABC transporter for nitrate, ATPase component 57% 302.4
D-cellobiose catabolism msiK lo MsiK protein, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized) 34% 56% 123.2 ABC transporter for nitrate, ATPase component 57% 302.4
L-arabinose catabolism xylGsa lo Xylose/arabinose import ATP-binding protein XylG; EC 7.5.2.13 (characterized, see rationale) 31% 91% 116.7 ABC transporter for nitrate, ATPase component 57% 302.4
glycerol catabolism glpS lo GlpS, component of Glycerol uptake porter, GlpSTPQV (characterized) 31% 62% 110.2 ABC transporter for nitrate, ATPase component 57% 302.4
D-cellobiose catabolism cbtF lo CbtF, component of Cellobiose and cellooligosaccharide porter (characterized) 32% 60% 106.7 ABC transporter for nitrate, ATPase component 57% 302.4
L-alanine catabolism braG lo NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 32% 89% 102.8 ABC transporter for nitrate, ATPase component 57% 302.4
L-histidine catabolism natE lo NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 32% 89% 102.8 ABC transporter for nitrate, ATPase component 57% 302.4
L-leucine catabolism natE lo NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 32% 89% 102.8 ABC transporter for nitrate, ATPase component 57% 302.4
L-proline catabolism natE lo NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 32% 89% 102.8 ABC transporter for nitrate, ATPase component 57% 302.4
L-serine catabolism braG lo NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 32% 89% 102.8 ABC transporter for nitrate, ATPase component 57% 302.4
L-threonine catabolism braG lo NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 32% 89% 102.8 ABC transporter for nitrate, ATPase component 57% 302.4
D-mannose catabolism TM1749 lo TM1749, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized) 32% 71% 92.8 ABC transporter for nitrate, ATPase component 57% 302.4

Sequence Analysis Tools

View WP_019386474.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MAYLELNNIYKTYGQDEHATEVLSNINLSIEEGEFVAIVGFTGSGKTTLVNLINGLLEPT
SGEVLFKGEPVQGTSHERGVIFQNYSLLPWLTVGQNVFMAVKEAFPKKSKKELNAIVAEY
VEMVSLTPAINKRPKELSGGMRQRVAVARALAMKPEMIIMDEPLGALDALTRGNLQDEIL
NIWGKEKRTALLITNDVDEGIYMADRIIPLRPGPNATLGPEFKIDIERPRDKTEMNDNAN
FKQTRNAIIEYLMDIGNERKSESSEEFILPDLSPKDFVNQFK

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory