Align alcohol dehydrogenase (EC 1.1.1.1) (characterized)
to candidate WP_143148066.1 P735_RS0114205 SDR family oxidoreductase
Query= BRENDA::Q4J702 (264 letters) >NCBI__GCF_000283015.1:WP_143148066.1 Length = 257 Score = 141 bits (355), Expect = 2e-38 Identities = 83/248 (33%), Positives = 133/248 (53%), Gaps = 3/248 (1%) Query: 7 FSVKGMNAVVLGASSGIGKAIAEMFSEMGGKVVLSDIDEEGLKRLSDSLRSRGHEVNHMK 66 F + G A+V+G + +G A+ E SE G + V+ D D+ D L +G +V+ +K Sbjct: 9 FKLTGKKAIVVGGAGDLGIAMVEAISEAGAQTVVIDYDDRVFDMCKD-LNKKGLDVSPLK 67 Query: 67 CDITDLNQVKKLVNFSLSVYGN-VDALYVTPSINVRKSIENYTYEDFEKVINVNLKGNFM 125 D++ + Q+K+ +L + G VD L + I R E + E++ KVI++NL F Sbjct: 68 ADVSQIEQIKESYKAALDILGGTVDILINSAGIQRRYPSEEFPEEEWSKVISINLDATFY 127 Query: 126 VVKEFLSVMKNNKGGGSVVLFSSIRGTVVEPGQSVYAMTKAGIIQLAKVAAAEYGKYNIR 185 K + M N GGG ++ +S+ + YA +K G+ QL K + ++ I Sbjct: 128 YCKYAGNTMLKN-GGGKIINIASLMSFLGGITIPAYAASKGGVAQLTKALSNDWAAKGIC 186 Query: 186 VNVIAPGVVDTPLTRQIKSDPEWFKAYTEKTILKRWATPEEIANVALFLAMPASSYITGT 245 VN IAPG +DT L + +D + + + +KRW T E++ + +FLA PAS YITGT Sbjct: 187 VNGIAPGYMDTQLNTALINDKKRTEEVFIRVPMKRWGTGEDLKGLTVFLASPASDYITGT 246 Query: 246 VIYVDGGW 253 +I VDGG+ Sbjct: 247 IIPVDGGY 254 Lambda K H 0.317 0.134 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 181 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 264 Length of database: 257 Length adjustment: 25 Effective length of query: 239 Effective length of database: 232 Effective search space: 55448 Effective search space used: 55448 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory