Align UDP-glucose 4-epimerase; Galactowaldenase; UDP-galactose 4-epimerase; EC 5.1.3.2 (characterized)
to candidate WP_019388646.1 P735_RS0113840 polysaccharide biosynthesis protein
Query= SwissProt::Q9ZDJ5 (341 letters) >NCBI__GCF_000283015.1:WP_019388646.1 Length = 653 Score = 138 bits (347), Expect = 5e-37 Identities = 103/307 (33%), Positives = 157/307 (51%), Gaps = 23/307 (7%) Query: 2 FVDKTLMITGGTGSFGNAVLSRFLKSNIINDIKEIRIFSRDEKKQEDMRIALNNSKLKFY 61 F +T+++TG GS G+ ++ + SN D+K + + + E D++ L Y Sbjct: 290 FRGETVLVTGAAGSIGSELVKQL--SNF--DVKHLILVDQAESALYDVQQDLKRDGKHNY 345 Query: 62 ---IGDVRNYQSIDDAM--HGVDYVFHAAALKQVPTCEFYPMEAINTNVLGAENVLSAAI 116 + D+R+ ID H VFHAAA K VP E P EAI NV G + + A Sbjct: 346 TAIVADIRDGLRIDSIFQTHKPTMVFHAAAYKHVPLMEKAPYEAIKINVNGTKLLADTAS 405 Query: 117 NNKVTKVIVLSTDKAVYPINAMGLSKALMEKLAIAKARMRSPGETILCVTRYGNVMASRG 176 V K + +STDKAV P + MG +K + E ++ +T TR+GNV+ S G Sbjct: 406 RYNVKKFVFVSTDKAVNPTSVMGATKRIAEMYITC---LQKESKTKFITTRFGNVLGSNG 462 Query: 177 SVIPLFIHQIKQGKELTITEPSMTRFLMSLVDSVDLVLYAFEHGRQGDIFV-QKSPASTI 235 SVIPLF QI+ G LT+T +TR+ M++ ++ LVL A G+ G+IF+ + I Sbjct: 463 SVIPLFKKQIEAGSSLTLTHKDITRYFMTIPEASQLVLEAGTMGKGGEIFIFDMGESVKI 522 Query: 236 EVLAKALQEIFGSKNA----IRFIGTRHGEKHYESLVSSEDMAKADDLGGYYR--IPMDG 289 LAK + + G + I G R GEK YE L+++ + + L Y++ + Sbjct: 523 FDLAKNMIRLSGLRYPEDIDINVTGLRPGEKLYEELLANGE----NTLSTYHKKILISKT 578 Query: 290 RDLNYAK 296 R+L+YAK Sbjct: 579 RELDYAK 585 Lambda K H 0.319 0.135 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 473 Number of extensions: 28 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 341 Length of database: 653 Length adjustment: 33 Effective length of query: 308 Effective length of database: 620 Effective search space: 190960 Effective search space used: 190960 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory