Align 2-dehydro-3-deoxy-phosphogluconate aldolase (EC 4.1.2.14) (characterized)
to candidate WP_019386449.1 P735_RS15290 bifunctional 4-hydroxy-2-oxoglutarate aldolase/2-dehydro-3-deoxy-phosphogluconate aldolase
Query= BRENDA::D4GV57 (219 letters) >NCBI__GCF_000283015.1:WP_019386449.1 Length = 216 Score = 130 bits (326), Expect = 2e-35 Identities = 75/200 (37%), Positives = 112/200 (56%), Gaps = 1/200 (0%) Query: 18 VVAVMRGADADTIIDVADALHEGGVTAYEITADNPDAMDLIREVSASFSDNEAIVGAGTA 77 V+A++R I + L EGG+ EIT++ P ++ I + + D++ I+GAGT Sbjct: 15 VIAIVRTDTQLHIPKLIQDLVEGGINVIEITSNTPGYLEEIAKARKKYPDSDIIIGAGTV 74 Query: 78 LDAPTANAAIQAGAEFVVGPNFDEGVVETCNRYGTLVAPGIMTPTEATDAYSAGADLVKV 137 +A A+AAIQAGA+F+V PN + V+ +R VA G +TPTE A GAD++K+ Sbjct: 75 TNAKIADAAIQAGAQFLVTPNTNTEVIALAHRNNIPVAMGALTPTEICVAAEHGADIIKL 134 Query: 138 FPASSLGPGHLKSMKGPLPQIPMMPTGGVGLDNAADYIEAGAVVVGAGGALMDDEAIENG 197 FPA LG + KS+K PL I GG+ L N ++I AG VG G AL +E +G Sbjct: 135 FPAGDLGISYFKSVKAPLDTITYFVVGGINLSNIEEWIAAGISGVGLGSALTKEEKTASG 194 Query: 198 DFEAITETAREFSNIIDDAR 217 T ++F II +++ Sbjct: 195 GAHN-KNTIQKFVKIIKESQ 213 Lambda K H 0.314 0.133 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 109 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 219 Length of database: 216 Length adjustment: 22 Effective length of query: 197 Effective length of database: 194 Effective search space: 38218 Effective search space used: 38218 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory