Align 4-hydroxy-2-oxoglutarate aldolase (EC 4.1.3.16; EC 4.1.2.55) (characterized)
to candidate WP_019388255.1 P735_RS0111850 bifunctional 4-hydroxy-2-oxoglutarate aldolase/2-dehydro-3-deoxy-phosphogluconate aldolase
Query= metacyc::MONOMER-4906 (205 letters) >NCBI__GCF_000283015.1:WP_019388255.1 Length = 222 Score = 124 bits (310), Expect = 2e-33 Identities = 77/204 (37%), Positives = 117/204 (57%), Gaps = 7/204 (3%) Query: 1 MKMEELFKKHKIVAVLRANSVEEAKEKALAVFEGGVHLIEITFTVPDADTVIKELS--FL 58 +++ + K ++ + N +E +K+ A ++GG L+E T A V EL+ + Sbjct: 7 LEVAQAMKDTGMIPLFFHNDIELSKKVLKACYDGGARLMEFTARGDFAHEVFGELTKYAI 66 Query: 59 KE-KGAIIGAGTVTSVEQCRKAVESGAEFIVSPHLDEEISQFCKEKGVFYMPGVMTPTEL 117 KE G I+G G+VT Q + GA FIV+P L E+I+ C + V + PG T TE+ Sbjct: 67 KELPGMIMGVGSVTDAGQASLYMTLGANFIVTPVLREDIAIACNRRKVLWSPGCGTLTEI 126 Query: 118 VKAMKLGHTILKLFPGEVVGPQFVKAMKGPFPNVKFVPTGGVN--LDNVCEWFKAGVLAV 175 +A +LG I+KLFPG++ GPQFVK +KGP +PTGGV+ +N+ WF AGV V Sbjct: 127 TRAEELGCEIVKLFPGDIYGPQFVKGIKGPQQWTSIMPTGGVSPTEENLKAWFDAGVTCV 186 Query: 176 GVGSALVKGTPDEVREKAKAFVEK 199 G+GS L+ + + + K A +EK Sbjct: 187 GMGSKLI--SKEIIANKDYAKLEK 208 Lambda K H 0.318 0.136 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 130 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 205 Length of database: 222 Length adjustment: 22 Effective length of query: 183 Effective length of database: 200 Effective search space: 36600 Effective search space used: 36600 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory