Align mannose-1-phosphate guanylyltransferase (EC 2.7.7.13); glucose-1-phosphate guanylyltransferase (EC 2.7.7.34); aldose-1-phosphate nucleotidyltransferase (EC 2.7.7.37); mannose-6-phosphate isomerase (EC 5.3.1.8) (characterized)
to candidate WP_026009899.1 P735_RS0101475 mannose-1-phosphate guanylyltransferase
Query= BRENDA::O58649 (464 letters) >NCBI__GCF_000283015.1:WP_026009899.1 Length = 359 Score = 208 bits (529), Expect = 3e-58 Identities = 124/364 (34%), Positives = 209/364 (57%), Gaps = 30/364 (8%) Query: 3 ALILAGGKGTRLWPLSREAMPKQFIKVF-SDRSLFQKTVERALIFSKPKEIFVVTNKEYR 61 A+++AGG G+R WP+S + PKQF + + +L QKT R + IF++TN+ Y Sbjct: 7 AILMAGGVGSRFWPISTQDFPKQFHDMLGTGDTLIQKTFHRLADLIPKENIFILTNERYN 66 Query: 62 FRVLDDLNELGLKVPEENILLEPVGKNTLPAI-YWGLKVINDNYGDSVVAVLPSDHAIEV 120 VL+ L E V + ++LEP +NT P I Y LK+ +N D+V+ V PSDH IE Sbjct: 67 DLVLEQLPE----VEQRQVVLEPAMRNTAPCILYASLKIQKEN-PDAVMIVAPSDHWIED 121 Query: 121 NESYMEAFKKAEKLAEKY--LVTFGIKPTKPHTGYGYIKPGEKIEVEGKVLGYLVDEFKE 178 +++ + ++A E L+T GI+PT P+TGYGYI+ + K V++F+E Sbjct: 122 EKTFSKNVQQAFDYCENNDALMTLGIQPTFPNTGYGYIEFDKSSAEAIKT----VNQFRE 177 Query: 179 KPDLETARKYVENG-YYWNSGMFMFKVSVFMEEARKHSPDVVKAFEEG----------KS 227 KPD ETA+ ++ G + WN+G+FM+ ++ + + P++ K FE G + Sbjct: 178 KPDYETAKSFISQGNFLWNAGIFMWSAKSVIKAFQNNQPELFKLFESGIPLYNTEFENEF 237 Query: 228 IEEIYELAPEISVDYGIMEKTNKAAVVPLNTYWNDLGSFDAVYEALEKDENGNAVHVTGF 287 I+E Y A +SVDY IMEK+ V+ WNDLG++ ++Y+ L+KDE+GNAV Sbjct: 238 IKENYPNAENVSVDYAIMEKSANVHVIAAEFDWNDLGTWGSLYDKLDKDESGNAV----V 293 Query: 288 KAKYINVDSRNNLVLT--ERLTATVGVEDLVIIDTGDALLVAKRGETQKVKEVYKKLKEE 345 A+ + D+ N++ T +++ G++D +++D + LL+ + + Q +K +++K++ Sbjct: 294 NARTLAEDASGNMIRTKKDKIVVIDGLQDYIVVDKEEVLLIFPKSKEQDIKMTLQQVKDK 353 Query: 346 NDER 349 E+ Sbjct: 354 FGEQ 357 Lambda K H 0.316 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 445 Number of extensions: 34 Number of successful extensions: 8 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 464 Length of database: 359 Length adjustment: 31 Effective length of query: 433 Effective length of database: 328 Effective search space: 142024 Effective search space used: 142024 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory