Align Probable NADP-dependent mannitol dehydrogenase; MtDH; Mannitol 2-dehydrogenase [NADP(+)]; Short chain dehydrogenase/reductase; YlSDR; EC 1.1.1.138 (characterized)
to candidate WP_143148066.1 P735_RS0114205 SDR family oxidoreductase
Query= SwissProt::Q6CEE9 (278 letters) >NCBI__GCF_000283015.1:WP_143148066.1 Length = 257 Score = 131 bits (329), Expect = 2e-35 Identities = 91/260 (35%), Positives = 141/260 (54%), Gaps = 15/260 (5%) Query: 23 KNIMERFSLKGKVASITGSSSGIGFAVAEAFAQAGAD-VAIWYNSKPSDEKAEYLSKTYG 81 +NI+E+F L GK A + G + +G A+ EA ++AGA V I Y+ + D + K G Sbjct: 3 QNILEQFKLTGKKAIVVGGAGDLGIAMVEAISEAGAQTVVIDYDDRVFDMCKDLNKK--G 60 Query: 82 VRSKAYKCAVTNAKQVETTIQT-IEKDFGKIDIFIANAGIPWTAGPMIDVPNNEEWDKVV 140 + K V+ +Q++ + + ++ G +DI I +AGI P + P EEW KV+ Sbjct: 61 LDVSPLKADVSQIEQIKESYKAALDILGGTVDILINSAGIQ-RRYPSEEFPE-EEWSKVI 118 Query: 141 DLDLNGAYYCAKYAGQIFKKQGYGSFIFTASMSGHI--VNIPQMQACYNAAKCAVLHLSR 198 ++L+ +Y KYAG K G G I AS+ + + IP Y A+K V L++ Sbjct: 119 SINLDATFYYCKYAGNTMLKNGGGKIINIASLMSFLGGITIP----AYAASKGGVAQLTK 174 Query: 199 SLAVEWAGFARC-NTVSPGYMATEISDFIPRDTK--EKWWQLIPMGREGDPSELAGAYIY 255 +L+ +WA C N ++PGYM T+++ + D K E+ + +PM R G +L G ++ Sbjct: 175 ALSNDWAAKGICVNGIAPGYMDTQLNTALINDKKRTEEVFIRVPMKRWGTGEDLKGLTVF 234 Query: 256 LASDASTYTTGADILVDGGY 275 LAS AS Y TG I VDGGY Sbjct: 235 LASPASDYITGTIIPVDGGY 254 Lambda K H 0.317 0.132 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 181 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 278 Length of database: 257 Length adjustment: 25 Effective length of query: 253 Effective length of database: 232 Effective search space: 58696 Effective search space used: 58696 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory