Align SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter (characterized)
to candidate WP_019386899.1 P735_RS0104925 ABC transporter ATP-binding protein
Query= TCDB::P54933 (332 letters) >NCBI__GCF_000283015.1:WP_019386899.1 Length = 303 Score = 128 bits (321), Expect = 2e-34 Identities = 72/236 (30%), Positives = 127/236 (53%), Gaps = 6/236 (2%) Query: 4 ITLRNVQKRFGEAVVIPSLDLDIEDGEFVVFVGPSGCGKSTLLRLIAGLEDVSDGQIMID 63 + ++N++ + + V+ ++ D GE V +G SG GKSTLL+++ G D+ +G I + Sbjct: 2 LIVKNLKFSYKKTAVLKNISFDANQGENVAIIGESGSGKSTLLKVLYGEYDLDEGHIFWN 61 Query: 64 GRDAT----EMPPAKRGLAMVFQSYALYPHMTVKKNIAFPLRMAKMEPQEIERRVSNAAK 119 + + + V Q + L P +TV++NI L ++ P+E RR + Sbjct: 62 DNEILGPKFNLVVGYDFMKYVAQEFDLMPFITVEENIGKFL--SRFYPEEKHRRTQELIE 119 Query: 120 ILNLTNYLDRRPGQLSGGQRQRVAIGRAIVREPAAFLFDEPLSNLDAALRVNMRLEITEL 179 ++ LT + + LSGGQ+QRVA+ RA+ ++P L DEP S++D + ++R + + Sbjct: 120 VVELTEFAKTKVKTLSGGQKQRVALARALAKQPEIILLDEPFSHIDNFKKQSLRRSVFKY 179 Query: 180 HQSLETTMIYVTHDQVEAMTMADKIVVLNAGRIEQVGSPLTLYRNPANLFVAGFIG 235 + T I THD+ + + AD+++VLN +I +P LY++P VA F G Sbjct: 180 LKDNHITCIVATHDKEDVLGYADQMIVLNNNKIAVKDTPEQLYKHPKTPLVASFFG 235 Lambda K H 0.320 0.137 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 190 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 332 Length of database: 303 Length adjustment: 27 Effective length of query: 305 Effective length of database: 276 Effective search space: 84180 Effective search space used: 84180 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory