GapMind for catabolism of small carbon sources

 

Protein WP_017179233.1 in Actinomyces timonensis 7400942

Annotation: NCBI__GCF_000295095.1:WP_017179233.1

Length: 448 amino acids

Source: GCF_000295095.1 in NCBI

Candidate for 26 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
N-acetyl-D-glucosamine catabolism ptsC hi IIC' aka PtsC2, component of N-Acetylglucosamine (NAG) porter (PtsBC1C2)(also may facilitate xylose transport) (characterized) 49% 97% 389.4 N-acetylglucosamine-specific PTS system, IIBC components (nagE) 47% 366.7
D-glucosamine (chitosamine) catabolism ptsC hi IIC' aka PtsC2, component of N-Acetylglucosamine (NAG) porter (PtsBC1C2)(also may facilitate xylose transport) (characterized) 49% 97% 389.4 N-acetylglucosamine-specific PTS system, IIBC components (nagE) 47% 366.7
N-acetyl-D-glucosamine catabolism nagPcb med PTS system N-acetylglucosamine-specific EIICB component; EIICB-Nag; EC 2.7.1.- (characterized) 45% 80% 336.3 IIC' aka PtsC2, component of N-Acetylglucosamine (NAG) porter (PtsBC1C2)(also may facilitate xylose transport) 49% 389.4
D-glucosamine (chitosamine) catabolism nagPcb med PTS system N-acetylglucosamine-specific EIICB component; EIICB-Nag; EC 2.7.1.- (characterized) 45% 80% 336.3 IIC' aka PtsC2, component of N-Acetylglucosamine (NAG) porter (PtsBC1C2)(also may facilitate xylose transport) 49% 389.4
D-cellobiose catabolism ptsG med PTS system glucose-specific EIICB component; EIICB-Glc; EII-Glc; EC 2.7.1.199 (characterized) 42% 84% 318.9 IIC' aka PtsC2, component of N-Acetylglucosamine (NAG) porter (PtsBC1C2)(also may facilitate xylose transport) 49% 389.4
D-glucose catabolism ptsG med PTS system glucose-specific EIICB component; EIICB-Glc; EII-Glc; EC 2.7.1.199 (characterized) 42% 84% 318.9 IIC' aka PtsC2, component of N-Acetylglucosamine (NAG) porter (PtsBC1C2)(also may facilitate xylose transport) 49% 389.4
lactose catabolism ptsG med PTS system glucose-specific EIICB component; EIICB-Glc; EII-Glc; EC 2.7.1.199 (characterized) 42% 84% 318.9 IIC' aka PtsC2, component of N-Acetylglucosamine (NAG) porter (PtsBC1C2)(also may facilitate xylose transport) 49% 389.4
D-maltose catabolism ptsG med PTS system glucose-specific EIICB component; EIICB-Glc; EII-Glc; EC 2.7.1.199 (characterized) 42% 84% 318.9 IIC' aka PtsC2, component of N-Acetylglucosamine (NAG) porter (PtsBC1C2)(also may facilitate xylose transport) 49% 389.4
sucrose catabolism ptsG med PTS system glucose-specific EIICB component; EIICB-Glc; EII-Glc; EC 2.7.1.199 (characterized) 42% 84% 318.9 IIC' aka PtsC2, component of N-Acetylglucosamine (NAG) porter (PtsBC1C2)(also may facilitate xylose transport) 49% 389.4
trehalose catabolism ptsG med PTS system glucose-specific EIICB component; EIICB-Glc; EII-Glc; EC 2.7.1.199 (characterized) 42% 84% 318.9 IIC' aka PtsC2, component of N-Acetylglucosamine (NAG) porter (PtsBC1C2)(also may facilitate xylose transport) 49% 389.4
N-acetyl-D-glucosamine catabolism nagEcb lo N-acetylglucosamine-specific PTS system, IIBC components (nagE) (characterized) 47% 67% 366.7 IIC' aka PtsC2, component of N-Acetylglucosamine (NAG) porter (PtsBC1C2)(also may facilitate xylose transport) 49% 389.4
D-glucosamine (chitosamine) catabolism nagEcb lo N-acetylglucosamine-specific PTS system, IIBC components (nagE) (characterized) 47% 67% 366.7 IIC' aka PtsC2, component of N-Acetylglucosamine (NAG) porter (PtsBC1C2)(also may facilitate xylose transport) 49% 389.4
N-acetyl-D-glucosamine catabolism nagEcba lo protein-Npi-phosphohistidine-N-acetyl-D-glucosamine phosphotransferase (EC 2.7.1.193) (characterized) 45% 58% 338.6 IIC' aka PtsC2, component of N-Acetylglucosamine (NAG) porter (PtsBC1C2)(also may facilitate xylose transport) 49% 389.4
D-glucosamine (chitosamine) catabolism nagEcba lo protein-Npi-phosphohistidine-N-acetyl-D-glucosamine phosphotransferase (EC 2.7.1.193) (characterized) 45% 58% 338.6 IIC' aka PtsC2, component of N-Acetylglucosamine (NAG) porter (PtsBC1C2)(also may facilitate xylose transport) 49% 389.4
D-glucosamine (chitosamine) catabolism gamP lo protein-Npi-phosphohistidine-N-acetyl-D-glucosamine phosphotransferase (EC 2.7.1.193) (characterized) 45% 59% 334.7 IIC' aka PtsC2, component of N-Acetylglucosamine (NAG) porter (PtsBC1C2)(also may facilitate xylose transport) 49% 389.4
D-cellobiose catabolism ptsG-crr lo PTS system glucoside-specific EIICBA component; EIICBA-Glc 2; EC 2.7.1.- (characterized) 41% 64% 329.3 IIC' aka PtsC2, component of N-Acetylglucosamine (NAG) porter (PtsBC1C2)(also may facilitate xylose transport) 49% 389.4
D-glucose catabolism ptsG-crr lo PTS system glucoside-specific EIICBA component; EIICBA-Glc 2; EC 2.7.1.- (characterized) 41% 64% 329.3 IIC' aka PtsC2, component of N-Acetylglucosamine (NAG) porter (PtsBC1C2)(also may facilitate xylose transport) 49% 389.4
lactose catabolism ptsG-crr lo PTS system glucoside-specific EIICBA component; EIICBA-Glc 2; EC 2.7.1.- (characterized) 41% 64% 329.3 IIC' aka PtsC2, component of N-Acetylglucosamine (NAG) porter (PtsBC1C2)(also may facilitate xylose transport) 49% 389.4
D-maltose catabolism ptsG-crr lo PTS system glucoside-specific EIICBA component; EIICBA-Glc 2; EC 2.7.1.- (characterized) 41% 64% 329.3 IIC' aka PtsC2, component of N-Acetylglucosamine (NAG) porter (PtsBC1C2)(also may facilitate xylose transport) 49% 389.4
sucrose catabolism ptsG-crr lo PTS system glucoside-specific EIICBA component; EIICBA-Glc 2; EC 2.7.1.- (characterized) 41% 64% 329.3 IIC' aka PtsC2, component of N-Acetylglucosamine (NAG) porter (PtsBC1C2)(also may facilitate xylose transport) 49% 389.4
trehalose catabolism ptsG-crr lo PTS system glucoside-specific EIICBA component; EIICBA-Glc 2; EC 2.7.1.- (characterized) 41% 64% 329.3 IIC' aka PtsC2, component of N-Acetylglucosamine (NAG) porter (PtsBC1C2)(also may facilitate xylose transport) 49% 389.4
N-acetyl-D-glucosamine catabolism nagEIIA lo Putative PTS system glucosamine-specific EIICBA component; EC 2.7.1.193 (characterized) 45% 60% 323.6 IIC' aka PtsC2, component of N-Acetylglucosamine (NAG) porter (PtsBC1C2)(also may facilitate xylose transport) 49% 389.4
D-glucosamine (chitosamine) catabolism nagEIIA lo Putative PTS system glucosamine-specific EIICBA component; EC 2.7.1.193 (characterized) 45% 60% 323.6 IIC' aka PtsC2, component of N-Acetylglucosamine (NAG) porter (PtsBC1C2)(also may facilitate xylose transport) 49% 389.4
D-maltose catabolism malEIIA lo Putative PTS system glucosamine-specific EIICBA component; EC 2.7.1.193 (characterized) 45% 60% 323.6 IIC' aka PtsC2, component of N-Acetylglucosamine (NAG) porter (PtsBC1C2)(also may facilitate xylose transport) 49% 389.4
trehalose catabolism treEIIA lo Putative PTS system glucosamine-specific EIICBA component; EC 2.7.1.193 (characterized) 45% 60% 323.6 IIC' aka PtsC2, component of N-Acetylglucosamine (NAG) porter (PtsBC1C2)(also may facilitate xylose transport) 49% 389.4
D-maltose catabolism malEIICB lo The Maltose group translocator, MalT of 470 aas and 10 TMSs. Takes up extracellular maltose, releasing maltose-phosphate into the cytoplasm (characterized) 33% 61% 162.5 IIC' aka PtsC2, component of N-Acetylglucosamine (NAG) porter (PtsBC1C2)(also may facilitate xylose transport) 49% 389.4

Sequence Analysis Tools

View WP_017179233.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MSQKKKGGAFAAAQRLGRSLMLPIATLPAASLLLRFGQADMLGADGVAKRLSWMQPVADV
LAQAGDAVFSHLPLIFAVGVAVGFAKKSDGSTGVAGLFGYLVLEGVLKALAPYLGAGGDG
DPAKSTINYGVLGGIIIGITAALLWQRFYRIKLPDWLAFFGGRRFVPIITSLAALAIGVV
LALIYPAFNWLINEQLGGWLMEAGTKGGAAAVIASFVFGTINRLLIPFGLHHLLNSIPWF
QLGDCTNASGQTVHGDLTCFFSGVDGTNAWTGSFMTGFFPIMMFALPGAALAIWRTARPE
KRKATGALMASVALTAFVTGITEPLEYAFAYVAFPLYAIHAVLTGTSLALVNALGIKDGF
GFSAGGIDYLLNFGKSADLSAQGVMGPVLLVVIGLAYALVYYALFRFLIIRLGFATPGRE
EDETDAFSAAQSAAAESTGKKAPGEQRR

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory