Align ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized)
to candidate WP_017177778.1 A1QA_RS0104755 ABC transporter ATP-binding protein
Query= reanno::Smeli:SMc04256 (361 letters) >NCBI__GCF_000295095.1:WP_017177778.1 Length = 386 Score = 224 bits (570), Expect = 4e-63 Identities = 126/270 (46%), Positives = 172/270 (63%), Gaps = 6/270 (2%) Query: 22 LNLDIDHGEFLVLLGSSGCGKSTLLNCIAGLLDVSDGQIFIKDRNVTWEEPKDRGIGMVF 81 ++LDI GEF+ LLG SGCGK+T L IAG D + GQ+ + +N+ P R + MVF Sbjct: 41 VSLDIAPGEFVTLLGPSGCGKTTTLRMIAGFEDTTSGQVVLDGQNMVSLPPNKRPMSMVF 100 Query: 82 QSYALYPQMTVEKNLSFGLKVAKIPPAEIEKRVKRASEILQIQPLLKRKPSELSGGQRQR 141 QSYAL+P ++V +N+++GLK+ P EI ++V+ A + + L R P+ELSGGQ+QR Sbjct: 101 QSYALFPHLSVRENIAYGLKLRHTKPEEIREQVEIALTSMNLNSLADRAPNELSGGQQQR 160 Query: 142 VAIGRALVRDVDVFLFDEPLSNLDAKLRSELRVEIKRLHQSLKNTMIYVTHDQIEALTLA 201 VA+ RA+V V LFDEPLSNLDAKLR +R+EI+RL Q + T IYVTHDQ EA+T++ Sbjct: 161 VALARAMVMRPKVLLFDEPLSNLDAKLRVRMRLEIRRLQQRMGITSIYVTHDQAEAMTMS 220 Query: 202 DRIAVMKSGVIQQLADPMTIYNAPENLFVAGFIGSPSMNFFRGEV-EPKDGRSFVRAGGI 260 DRI VM +G I+Q+A P IY P ++FVA FIG NF + GR R G Sbjct: 221 DRIVVMNAGTIEQVATPEKIYRRPASVFVADFIG--RANFLAATARDVGGGRCSARVLGA 278 Query: 261 AFDVTAYPAHTRLQPGQKVVLGLRPEHVKV 290 D+ A H + G V + +RPE V++ Sbjct: 279 --DLQA-ACHEGVSAGSGVTVIVRPESVRL 305 Lambda K H 0.320 0.137 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 370 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 361 Length of database: 386 Length adjustment: 30 Effective length of query: 331 Effective length of database: 356 Effective search space: 117836 Effective search space used: 117836 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory