Align ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized)
to candidate WP_017177778.1 A1QA_RS0104755 ABC transporter ATP-binding protein
Query= reanno::pseudo13_GW456_L13:PfGW456L13_1897 (386 letters) >NCBI__GCF_000295095.1:WP_017177778.1 Length = 386 Score = 239 bits (611), Expect = 7e-68 Identities = 133/306 (43%), Positives = 183/306 (59%), Gaps = 21/306 (6%) Query: 4 LELRNVNKTYGPGLPDT--LKNIELKIDDGEFLILVGPSGCGKSTLMNCIAGLETISGGA 61 LELR+V K + D + + L I GEF+ L+GPSGCGK+T + IAG E + G Sbjct: 19 LELRDVVKVFSNRGKDVYAVHGVSLDIAPGEFVTLLGPSGCGKTTTLRMIAGFEDTTSGQ 78 Query: 62 ILVDDADISGMSPKDRDIAMVFQSYALYPTMSVRDNIAFGLKIRKMPTAEIDEEVARVSK 121 +++D ++ + P R ++MVFQSYAL+P +SVR+NIA+GLK+R EI E+V Sbjct: 79 VVLDGQNMVSLPPNKRPMSMVFQSYALFPHLSVRENIAYGLKLRHTKPEEIREQVEIALT 138 Query: 122 LLQIEHLLSRKPGQLSGGQQQRVAMGRALARRPKIYLFDEPLSNLDAKLRVEMRTEMKLM 181 + + L R P +LSGGQQQRVA+ RA+ RPK+ LFDEPLSNLDAKLRV MR E++ + Sbjct: 139 SMNLNSLADRAPNELSGGQQQRVALARAMVMRPKVLLFDEPLSNLDAKLRVRMRLEIRRL 198 Query: 182 HQRLKTTTVYVTHDQIEAMTLGDKVAVMKDGIIQQFGTPKDIYNNPANLFVASFIGSPPM 241 QR+ T++YVTHDQ EAMT+ D++ VM G I+Q TP+ IY PA++FVA FIG Sbjct: 199 QQRMGITSIYVTHDQAEAMTMSDRIVVMNAGTIEQVATPEKIYRRPASVFVADFIGR--A 256 Query: 242 NFIPLRLQRKDGRLLALLDSGQARC-------ELPLGMQDAGLEDREVILGIRPEQIILA 294 NF+ + D G RC +L + V + +RPE + L+ Sbjct: 257 NFLAATAR----------DVGGGRCSARVLGADLQAACHEGVSAGSGVTVIVRPESVRLS 306 Query: 295 NGEANG 300 G G Sbjct: 307 PGTGEG 312 Lambda K H 0.319 0.138 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 426 Number of extensions: 17 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 386 Length of database: 386 Length adjustment: 30 Effective length of query: 356 Effective length of database: 356 Effective search space: 126736 Effective search space used: 126736 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory