Align ABC transporter for D-Glucosamine, permease component 2 (characterized)
to candidate WP_026048784.1 A1QA_RS0107465 sugar ABC transporter permease
Query= reanno::Smeli:SM_b21220 (293 letters) >NCBI__GCF_000295095.1:WP_026048784.1 Length = 301 Score = 132 bits (331), Expect = 1e-35 Identities = 83/279 (29%), Positives = 145/279 (51%), Gaps = 9/279 (3%) Query: 11 WLLMLPLLVVMTAVIGWPLVDTVRLSFTDAKLVGTEGGFVGTANYIKMLGGSNFQRALVT 70 W + P + + A WPL+ + LSFT+ L+ T F G ANY +M+ F A+ Sbjct: 23 WAFIAPAGIGLLAFYIWPLLRGIWLSFTEYNLL-TPASFNGLANYSRMVQDKIFWNAVWV 81 Query: 71 TTWFAVISVAAEMVLGVLAALLLNQQFRGRTALRALMILPWALPTVVNATLWRLIYNPEY 130 T + VI++ + +L ++ A+L+ Q+ T +R++++ P+ + VV A LW + + Sbjct: 82 TLEYVVINIGLQTILALVIAVLM-QRLTQSTLVRSIVLTPYLVSNVVAAMLWLWLLDNTL 140 Query: 131 GALNAALTQL--GLLDSYRSWLGEPGTALAALIVADCWKNFPLVALIALAALQAVPRDIT 188 G N + + +D + S L A+ + V + W++ AL+ A LQA+P D+ Sbjct: 141 GISNQIIEAVVGDRVDFFSSSL-----AIPTIAVINVWRHVGYTALLIFAGLQAIPGDVY 195 Query: 189 AASLVDGAGPFNRFRFVIMPYLAGPLLVALVLRTIEAFKVFDIIWVMTRGGPANSTRTLS 248 A +DGA + F + MP L L + L++ I +F+VFD + V T GGP N+TR L Sbjct: 196 EAGKMDGASEWTMFWRITMPLLRPILALVLIMTMIGSFQVFDTVSVTTGGGPVNATRVLQ 255 Query: 249 ILVYQEAFSFQRAGSGASLALIVTLLVTILAAAYAALLR 287 +Y AF + G +++A+ + L++ + A + R Sbjct: 256 FYLYDMAFGRFQFGYASAMAVGLLLILAAITALQYRMTR 294 Lambda K H 0.326 0.138 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 252 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 293 Length of database: 301 Length adjustment: 26 Effective length of query: 267 Effective length of database: 275 Effective search space: 73425 Effective search space used: 73425 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory