Align 2-dehydro-3-deoxygluconokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; EC 2.7.1.45 (characterized)
to candidate WP_017177971.1 A1QA_RS0105755 ribokinase
Query= SwissProt::Q704D0 (325 letters) >NCBI__GCF_000295095.1:WP_017177971.1 Length = 303 Score = 70.1 bits (170), Expect = 7e-17 Identities = 83/275 (30%), Positives = 116/275 (42%), Gaps = 36/275 (13%) Query: 47 VAGSEANFCIAATMAGARCSLIARVGDDEFGRNIVEYLRGRGVDVSHVKVDPGAPTGIYF 106 + G AN AA GA + VG D G + E LRG GVDV ++ D TGI F Sbjct: 37 LGGKGANQAAAAAHGGAEALFVGCVGGDASGITLREELRGHGVDVGALRTDEEITTGIAF 96 Query: 107 VQRHFPVPGRSRLIYYRKGSAGSRV-GPDDVDSSLISSADAVHSTG-ITLALSDSANRAV 164 + G + +I A +RV G ++ + + D V G I A ++ Sbjct: 97 IT--VSAAGENTIIL--DAGANARVTGSHAAEAIGLEAGDVVVLQGEIPAATNEEIIDWT 152 Query: 165 HKAFGEAKRRTFDTNIRPALWPDLAAARRAILDVLNYGVDVLVTDPDDTQILLG---VRD 221 H+A N+ P + A +LD VDVLV + + ++LG Sbjct: 153 HRAGARVV-----LNLAP-----VYAIAPQVLD----SVDVLVVNETECGLVLGSPAPGT 198 Query: 222 PEEAYRK---YRELGVQTLVYKLGAEGAYVFWNGGSYFRDALKVA-VEDPTGAGDAVAGY 277 PEEA RE G+ +++ LGA GA GS AL + V D TGAGDA G Sbjct: 199 PEEALASAAALRERGIASVLVTLGAAGAVWACAEGSGHLPALDLGPVVDTTGAGDASVGV 258 Query: 278 FVALYLSGVDPRRALDLAVAASALVVGVRGDNEAL 312 A +G D ASA+ G+R + A+ Sbjct: 259 LAAALAAGHD---------FASAVAEGMRAGSTAV 284 Lambda K H 0.319 0.137 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 235 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 325 Length of database: 303 Length adjustment: 27 Effective length of query: 298 Effective length of database: 276 Effective search space: 82248 Effective search space used: 82248 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory