Align NgcF, component of N-Acetylglucosamine/N,N'-diacetyl chitobiose porter (NgcK (C) not identified) (characterized)
to candidate WP_026048784.1 A1QA_RS0107465 sugar ABC transporter permease
Query= TCDB::Q8RJU9 (308 letters) >NCBI__GCF_000295095.1:WP_026048784.1 Length = 301 Score = 122 bits (305), Expect = 1e-32 Identities = 88/286 (30%), Positives = 146/286 (51%), Gaps = 22/286 (7%) Query: 17 LGLYALLVVWPFIQSIYYSFTDWTGLSPDFKTVGFDNYERMLDDDIFWKSLQHSLLFALL 76 +GL A + WP ++ I+ SFT++ L+P G NY RM+ D IFW ++ +L + Sbjct: 31 IGLLAFYI-WPLLRGIWLSFTEYNLLTPASFN-GLANYSRMVQDKIFWNAVWVTLEYV-- 86 Query: 77 LPVVTIGLALFFAFMINVGGRRRRGGPVITGVRGSGFYKIVYFFPQVLSIAIVALLFAFA 136 V+ IGL A +I V +R + S + + P ++S + A+L+ + Sbjct: 87 --VINIGLQTILALVIAVLMQR---------LTQSTLVRSIVLTPYLVSNVVAAMLWLWL 135 Query: 137 YNPDSGAINSLLRGIGLGDVQPVWLGDPDLALWCVMAVIVWSTVGFFVVLFSAGMASIPA 196 + G N ++ + +GD V LA+ + + VW VG+ +L AG+ +IP Sbjct: 136 LDNTLGISNQIIEAV-VGD--RVDFFSSSLAIPTIAVINVWRHVGYTALLIFAGLQAIPG 192 Query: 197 DIYEAALLDGANRVTTFFRITLPLLWDTVQSGWVYMGILALGAESFAVVHIMTTGPGGPD 256 D+YEA +DGA+ T F+RIT+PLL + + + + +G+ +TTG GGP Sbjct: 193 DVYEAGKMDGASEWTMFWRITMPLLRPILA---LVLIMTMIGSFQVFDTVSVTTG-GGPV 248 Query: 257 YSTTVMVLYVYQKAFRDGQAAYATTIGVALLIVTLAFAAVVMRLGR 302 +T V+ Y+Y AF Q YA+ + V LL++ A A+ R+ R Sbjct: 249 NATRVLQFYLYDMAFGRFQFGYASAMAVGLLLILAAITALQYRMTR 294 Lambda K H 0.330 0.145 0.458 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 279 Number of extensions: 20 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 308 Length of database: 301 Length adjustment: 27 Effective length of query: 281 Effective length of database: 274 Effective search space: 76994 Effective search space used: 76994 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory