Align GlpP, component of Glycerol uptake porter, GlpSTPQV (characterized)
to candidate WP_026048784.1 A1QA_RS0107465 sugar ABC transporter permease
Query= TCDB::G3LHZ0 (288 letters) >NCBI__GCF_000295095.1:WP_026048784.1 Length = 301 Score = 107 bits (266), Expect = 4e-28 Identities = 67/230 (29%), Positives = 117/230 (50%), Gaps = 13/230 (5%) Query: 62 FWESLQRNLLFSFIILALEIPLGIFIALNMPKSGPGVPVCLVLMALPLLIPWNVVGTIWQ 121 FW ++ L + I + L+ L + IA+ M + V +++ P L+ V +W Sbjct: 75 FWNAVWVTLEYVVINIGLQTILALVIAVLMQRLTQSTLVRSIVLT-PYLVSNVVAAMLWL 133 Query: 122 VFGRVDIGLLGHTLEAIGLDYNYVRDPID------AWVTVIVMDVWHWTSLVVLLCYAGL 175 +G+ +EA+ V D +D A T+ V++VW LL +AGL Sbjct: 134 WLLDNTLGISNQIIEAV------VGDRVDFFSSSLAIPTIAVINVWRHVGYTALLIFAGL 187 Query: 176 VSIPDAYYQAAKIDGASRWSVFRYIQLPKMKRVLLIAVLLRFMDSFMIYTEPFVVTGGGP 235 +IP Y+A K+DGAS W++F I +P ++ +L + +++ + SF ++ V TGGGP Sbjct: 188 QAIPGDVYEAGKMDGASEWTMFWRITMPLLRPILALVLIMTMIGSFQVFDTVSVTTGGGP 247 Query: 236 GNSTTFLSIDLVKMAVGQFDLGPAAAMSIIYFLIILLLSWVFYTVMTSSD 285 N+T L L MA G+F G A+AM++ LI+ ++ + Y + + + Sbjct: 248 VNATRVLQFYLYDMAFGRFQFGYASAMAVGLLLILAAITALQYRMTRAGE 297 Lambda K H 0.329 0.143 0.464 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 247 Number of extensions: 16 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 288 Length of database: 301 Length adjustment: 26 Effective length of query: 262 Effective length of database: 275 Effective search space: 72050 Effective search space used: 72050 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory