Align High-affinity branched-chain amino acid transport ATP-binding protein (characterized, see rationale)
to candidate WP_017177725.1 A1QA_RS0104460 ABC transporter ATP-binding protein
Query= uniprot:A0A159ZWL6 (233 letters) >NCBI__GCF_000295095.1:WP_017177725.1 Length = 372 Score = 99.4 bits (246), Expect = 9e-26 Identities = 67/214 (31%), Positives = 115/214 (53%), Gaps = 5/214 (2%) Query: 12 GKIQALHSVNVEVRQGEIVTLIGANGAGKSTLLMTLCGSPQAHSGSIRYMGEELVGQDSS 71 G + A+ V++E+ G IV L+GA+G+GKS+LL + G +GSIR+ G ++VG + Sbjct: 21 GPVVAVDGVDLEIPAGRIVALLGASGSGKSSLLRAVAGLEPVAAGSIRWDGRDVVG---T 77 Query: 72 HIMRKSIAVVPEGRRVFARLTVEENLAMGGFFTDKGDYQEQMDKVLHLFPRLKERFTQRG 131 + R+ ++ + ++F V N+A G + + ++ ++L L L + Sbjct: 78 PVHRRGFGLMFQEGQLFPFRDVGGNVAYGLTGLPRAERARRVAEMLELV-GLPGYGPRPI 136 Query: 132 GTMSGGEQQMLAIGRALMSKPKLLLLDEPSLGLAPIIIQQI-FDIIEQLRKDGVTVFLVE 190 T+SGG+ Q +A+ RAL +P+LLLLDEP L + +Q+ D+ L + G T V Sbjct: 137 TTLSGGQAQRVALARALAPRPRLLLLDEPLSALDRALREQLAVDLRAILAEQGTTALYVT 196 Query: 191 QNANQALKIADRAYVLENGRVVMQGTGEALLTDP 224 + ++A+ +AD V+E GR+ L DP Sbjct: 197 HDQDEAMTVADEVGVMEAGRLARLAAPAELWADP 230 Lambda K H 0.320 0.137 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 214 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 233 Length of database: 372 Length adjustment: 26 Effective length of query: 207 Effective length of database: 346 Effective search space: 71622 Effective search space used: 71622 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory