Align ABC transporter for Lactose, ATPase component (characterized)
to candidate WP_017177725.1 A1QA_RS0104460 ABC transporter ATP-binding protein
Query= reanno::Smeli:SM_b20002 (358 letters) >NCBI__GCF_000295095.1:WP_017177725.1 Length = 372 Score = 167 bits (423), Expect = 4e-46 Identities = 101/283 (35%), Positives = 153/283 (54%), Gaps = 8/283 (2%) Query: 14 GGLEVIKGVDLDIKSGEFVVFVGPSGCGKSTLLRMIAGLEEISSGDLTIDDVRMNDVDPS 73 G + + GVDL+I +G V +G SG GKS+LLR +AGLE +++G + D + Sbjct: 21 GPVVAVDGVDLEIPAGRIVALLGASGSGKSSLLRAVAGLEPVAAGSIRWDGRDVVGTPVH 80 Query: 74 KRGIAMVFQSYALYPHMTVRENMGFALRFAGVPRAEIEKRVNEAAHILELGALLDRKPKQ 133 +RG ++FQ L+P V N+ + L G+PRAE +RV E ++ L R Sbjct: 81 RRGFGLMFQEGQLFPFRDVGGNVAYGL--TGLPRAERARRVAEMLELVGLPGYGPRPITT 138 Query: 134 LSGGQRQRVAIGRAIVRHPKIFLFDEPLSNLDAELRVHMRIEIARLHKQLATTIVYVTHD 193 LSGGQ QRVA+ RA+ P++ L DEPLS LD LR + +++ + + TT +YVTHD Sbjct: 139 LSGGQAQRVALARALAPRPRLLLLDEPLSALDRALREQLAVDLRAILAEQGTTALYVTHD 198 Query: 194 QVEAMTLADKIVVMRAGVVEQVGSPLDLYDDPANLFVAGFIG------SPKMNFLKGVIE 247 Q EAMT+AD++ VM AG + ++ +P +L+ DP + VA F+G + L + Sbjct: 199 QDEAMTVADEVGVMEAGRLARLAAPAELWADPGSASVAAFLGFGPILTREQTEALGWAVL 258 Query: 248 IDEDQAYARLPDYGDAKIPVTLQAAAGTAVTIGIRPEHFDEAG 290 +D + AR G + L A + V + D+AG Sbjct: 259 LDGGRPGAREAGSGGGGAALALAPGALSVVGLAGEAPRGDDAG 301 Lambda K H 0.321 0.139 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 359 Number of extensions: 19 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 358 Length of database: 372 Length adjustment: 30 Effective length of query: 328 Effective length of database: 342 Effective search space: 112176 Effective search space used: 112176 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory