Align LacK, component of Lactose porter (characterized)
to candidate WP_017177778.1 A1QA_RS0104755 ABC transporter ATP-binding protein
Query= TCDB::Q01937 (363 letters) >NCBI__GCF_000295095.1:WP_017177778.1 Length = 386 Score = 258 bits (658), Expect = 2e-73 Identities = 152/364 (41%), Positives = 218/364 (59%), Gaps = 19/364 (5%) Query: 4 VRLTDIRKSYGS----LEVIKGVNLEVSSGEFVVFVGPSGCGKSTLLRMIAGLEDISSGE 59 + L D+ K + + + + GV+L+++ GEFV +GPSGCGK+T LRMIAG ED +SG+ Sbjct: 19 LELRDVVKVFSNRGKDVYAVHGVSLDIAPGEFVTLLGPSGCGKTTTLRMIAGFEDTTSGQ 78 Query: 60 LTIGGTVMNDVDPSKRGIAMVFQTYALYPHMTVRENMGFALRFAGMAKDEIERRVNAAAK 119 + + G M + P+KR ++MVFQ+YAL+PH++VREN+ + L+ +EI +V A Sbjct: 79 VVLDGQNMVSLPPNKRPMSMVFQSYALFPHLSVRENIAYGLKLRHTKPEEIREQVEIALT 138 Query: 120 ILELDALMDRKPKALSGGQRQRVAIGRAIVRQPDVFLFDEPLSNLDAELRVHMRVEIARL 179 + L++L DR P LSGGQ+QRVA+ RA+V +P V LFDEPLSNLDA+LRV MR+EI RL Sbjct: 139 SMNLNSLADRAPNELSGGQQQRVALARAMVMRPKVLLFDEPLSNLDAKLRVRMRLEIRRL 198 Query: 180 HKELNATIVYVTHDQVEAMTLADKIVVMRGGIVEQVGAPLALYDDPDNMFVAGFIGSPRM 239 + + T +YVTHDQ EAMT++D+IVVM G +EQV P +Y P ++FVA FIG R Sbjct: 199 QQRMGITSIYVTHDQAEAMTMSDRIVVMNAGTIEQVATPEKIYRRPASVFVADFIG--RA 256 Query: 240 NFLPAVVIGQAEGGQVTVALKARPDTQLTVACATPPQGGDAVTVGVRPEHF-----LPAG 294 NFL A GG+ + + L AC G VTV VRPE G Sbjct: 257 NFL-AATARDVGGGRCSARVLG---ADLQAACHEGVSAGSGVTVIVRPESVRLSPGTGEG 312 Query: 295 SGDTQLT-AHVDVVEHL--GNTSYVYAHTVPGEQIIIEQE-ERRHGGRYGDEIAVGISAK 350 +G ++L AH V+ + G+ T G + +E + E GD++ V + A Sbjct: 313 AGGSELVGAHGRVLSSVFYGDHVEYEVETEAGTILCVESDPEPSSVHAEGDDVMVAVEAS 372 Query: 351 TSFL 354 +++ Sbjct: 373 RAWV 376 Lambda K H 0.320 0.137 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 389 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 363 Length of database: 386 Length adjustment: 30 Effective length of query: 333 Effective length of database: 356 Effective search space: 118548 Effective search space used: 118548 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory