Align ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized)
to candidate WP_017177725.1 A1QA_RS0104460 ABC transporter ATP-binding protein
Query= reanno::Smeli:SMc03065 (362 letters) >NCBI__GCF_000295095.1:WP_017177725.1 Length = 372 Score = 166 bits (420), Expect = 9e-46 Identities = 127/356 (35%), Positives = 177/356 (49%), Gaps = 36/356 (10%) Query: 3 GLLLKDIRKSY------GAVDVIHGIDLDIKEGEFVVFVGPSGCGKSTLLRMIAGLEEIT 56 GL + +R Y G V + G+DL+I G V +G SG GKS+LLR +AGLE + Sbjct: 4 GLTIDGLRVVYPGGRGAGPVVAVDGVDLEIPAGRIVALLGASGSGKSSLLRAVAGLEPVA 63 Query: 57 GGDMFIDGERVNDVPPSKRGIAMVFQSYALYPHMTVYDNMAFGMRIARESKEEIDRRVRG 116 G + DG V P +RG ++FQ L+P V N+A+G + + E RRV Sbjct: 64 AGSIRWDGRDVVGTPVHRRGFGLMFQEGQLFPFRDVGGNVAYG--LTGLPRAERARRVAE 121 Query: 117 AADMLQLTPYLDRLPKALSGGQRQRVAIGRAICRNPKVFLFDEPLSNLDAALRVATRIEI 176 +++ L Y R LSGGQ QRVA+ RA+ P++ L DEPLS LD ALR +++ Sbjct: 122 MLELVGLPGYGPRPITTLSGGQAQRVALARALAPRPRLLLLDEPLSALDRALREQLAVDL 181 Query: 177 -AKLSERMSDTTMIYVTHDQVEAMTLADRIVVLSAGHIEQVGAPLELYERPANLFVARFI 235 A L+E+ TT +YVTHDQ EAMT+AD + V+ AG + ++ AP EL+ P + VA F+ Sbjct: 182 RAILAEQ--GTTALYVTHDQDEAMTVADEVGVMEAGRLARLAAPAELWADPGSASVAAFL 239 Query: 236 GSPAMNVIPATITATGQQT-----AVSLAGGKSVTLDVPTNASENGKTASFGVRPEDLRV 290 G + T +QT AV L GG+ + A G A+ + P L V Sbjct: 240 GFGPI--------LTREQTEALGWAVLLDGGRPGARE----AGSGGGGAALALAPGALSV 287 Query: 291 T-------EADDFLFEGTVSIVEALGEVTLLYI-EGLVENEPIIAKMPGIARVGRG 338 DD GT + E G V + G VE + + G A V G Sbjct: 288 VGLAGEAPRGDDAGAPGTAMLPEVSGTVLARRVRRGRVEADVSLDFPDGDAVVATG 343 Lambda K H 0.320 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 336 Number of extensions: 20 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 372 Length adjustment: 30 Effective length of query: 332 Effective length of database: 342 Effective search space: 113544 Effective search space used: 113544 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory