Align Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale)
to candidate WP_017177778.1 A1QA_RS0104755 ABC transporter ATP-binding protein
Query= uniprot:A8LLL2 (373 letters) >NCBI__GCF_000295095.1:WP_017177778.1 Length = 386 Score = 232 bits (591), Expect = 1e-65 Identities = 133/295 (45%), Positives = 180/295 (61%), Gaps = 9/295 (3%) Query: 4 LKLTGVEKAYG----DVKVLSNINLDIQQGELIVFVGPSGCGKSTLLRMIAGLEKITGGT 59 L+L V K + DV + ++LDI GE + +GPSGCGK+T LRMIAG E T G Sbjct: 19 LELRDVVKVFSNRGKDVYAVHGVSLDIAPGEFVTLLGPSGCGKTTTLRMIAGFEDTTSGQ 78 Query: 60 LEIDGTVVNDVPPAQRGIAMVFQSYALYPHMTVRENMSFALKIAKKSQAEIDAAVEAAAE 119 + +DG + +PP +R ++MVFQSYAL+PH++VREN+++ LK+ EI VE A Sbjct: 79 VVLDGQNMVSLPPNKRPMSMVFQSYALFPHLSVRENIAYGLKLRHTKPEEIREQVEIALT 138 Query: 120 KLQLGQYLDRLPKALSGGQRQRVAIGRSIVRDPKVYLFDEPLSNLDAALRVATRLEIAQL 179 + L DR P LSGGQ+QRVA+ R++V PKV LFDEPLSNLDA LRV RLEI +L Sbjct: 139 SMNLNSLADRAPNELSGGQQQRVALARAMVMRPKVLLFDEPLSNLDAKLRVRMRLEIRRL 198 Query: 180 KEAMPESTMVYVTHDQVEAMTLATRIVVLAGGGIAQVGSPLELYEKPENEFVAQFIGSPK 239 ++ M T +YVTHDQ EAMT++ RIVV+ G I QV +P ++Y +P + FVA FIG Sbjct: 199 QQRM-GITSIYVTHDQAEAMTMSDRIVVMNAGTIEQVATPEKIYRRPASVFVADFIGRAN 257 Query: 240 MNLLPGKIIGTGAQTTVEMTDGGRAVSDYPSDDSLMGAAVNVGVRPEDMVEAAPG 294 + +G G + + G + + G+ V V VRPE V +PG Sbjct: 258 FLAATARDVGGGRCSARVL---GADLQAACHEGVSAGSGVTVIVRPES-VRLSPG 308 Lambda K H 0.316 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 420 Number of extensions: 27 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 373 Length of database: 386 Length adjustment: 30 Effective length of query: 343 Effective length of database: 356 Effective search space: 122108 Effective search space used: 122108 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory