Align Sugar ABC transporter ATP-binding protein (characterized, see rationale)
to candidate WP_017178740.1 A1QA_RS0109835 amino acid ABC transporter ATP-binding protein
Query= uniprot:A0A165KQ08 (355 letters) >NCBI__GCF_000295095.1:WP_017178740.1 Length = 270 Score = 156 bits (395), Expect = 5e-43 Identities = 101/256 (39%), Positives = 146/256 (57%), Gaps = 27/256 (10%) Query: 7 IAGINKRFGKGDKSVEVLRKVDIHVAPGEFLILVGPSGCGKSTLLNIIAGLDEPTEGEIR 66 IAG++K F + + VLR VD+ V G +LVGPSG GKSTLL I L+ G + Sbjct: 19 IAGLHKFFDE----LHVLRGVDLTVPAGTVTVLVGPSGSGKSTLLRCINELESIDAGRVW 74 Query: 67 IGGKNVVGM---PPRD-----------------RDIAMVFQSYALYPTLSVADNIGFA-L 105 + G+ ++GM P RD I MVFQ + L+P ++ N+ A + Sbjct: 75 VDGE-LIGMREVPGRDGTPVLHALSDKDRAAQRAKIGMVFQRFNLFPHMTALQNVMEAPV 133 Query: 106 EMRKMPKPERQKRIDEVAAMLQISHLLDRRPSQLSGGQRQRVAMGRALARQPQLFLFDEP 165 +++MPK + +KR E+ + ++ +D PSQLSGGQ+QRVA+ RALA P+L LFDEP Sbjct: 134 HVKRMPKEQARKRAAELLERVGLADRMDHYPSQLSGGQQQRVAIARALAMDPELMLFDEP 193 Query: 166 LSNLDAKLRVEMRAEIKRLHQASGITSVYVTHDQVEAMTLGSRIAVMKGGVVQQLGTPDE 225 S LD +L E+ + +K L + G+T V VTH+ A +G ++ M GGVV + G P E Sbjct: 194 TSALDPELVGEVLSVMKDLAR-DGMTMVVVTHEMGFAREVGDQLLFMDGGVVVERGVPSE 252 Query: 226 IYNRPANTYVATFIGS 241 + +RPAN F+ S Sbjct: 253 VLDRPANERTRAFLSS 268 Lambda K H 0.318 0.135 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 237 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 355 Length of database: 270 Length adjustment: 27 Effective length of query: 328 Effective length of database: 243 Effective search space: 79704 Effective search space used: 79704 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory