Align Maltose-transporting ATPase (EC 3.6.3.19) (characterized)
to candidate WP_017177778.1 A1QA_RS0104755 ABC transporter ATP-binding protein
Query= reanno::psRCH2:GFF857 (371 letters) >NCBI__GCF_000295095.1:WP_017177778.1 Length = 386 Score = 253 bits (647), Expect = 5e-72 Identities = 139/285 (48%), Positives = 181/285 (63%), Gaps = 8/285 (2%) Query: 6 LRDICKSYDGTP----ITRHIDLDIEDGEFVVFVGPSGCGKSTLLRLIAGLEDITSGDLL 61 LRD+ K + + LDI GEFV +GPSGCGK+T LR+IAG ED TSG ++ Sbjct: 21 LRDVVKVFSNRGKDVYAVHGVSLDIAPGEFVTLLGPSGCGKTTTLRMIAGFEDTTSGQVV 80 Query: 62 IDNQRVNDLPPKDRSVGMVFQSYALYPHMTVAENMAFGLKLASVDKREIKRRVEAVAEIL 121 +D Q + LPP R + MVFQSYAL+PH++V EN+A+GLKL EI+ +VE + Sbjct: 81 LDGQNMVSLPPNKRPMSMVFQSYALFPHLSVRENIAYGLKLRHTKPEEIREQVEIALTSM 140 Query: 122 QLDKLLERKPKDLSGGQRQRVAIGRTMVREPKVFLFDEPLSNLDAFLRVQMRIEIARLHQ 181 L+ L +R P +LSGGQ+QRVA+ R MV PKV LFDEPLSNLDA LRV+MR+EI RL Q Sbjct: 141 NLNSLADRAPNELSGGQQQRVALARAMVMRPKVLLFDEPLSNLDAKLRVRMRLEIRRLQQ 200 Query: 182 RIRSTMIYVTHDQVEAMTLADKIVVLNAGEIAQVGQPLHLYHYPKNRFVAGFLGSPQMNF 241 R+ T IYVTHDQ EAMT++D+IVV+NAG I QV P +Y P + FVA F+G + NF Sbjct: 201 RMGITSIYVTHDQAEAMTMSDRIVVMNAGTIEQVATPEKIYRRPASVFVADFIG--RANF 258 Query: 242 VEVRAISASPETVTIELPSGYPLTLPVDGSAVSPGDPLTLGIRPE 286 + A + + +G VS G +T+ +RPE Sbjct: 259 LAATARDVGGGRCSARVLGADLQAACHEG--VSAGSGVTVIVRPE 301 Lambda K H 0.322 0.139 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 374 Number of extensions: 12 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 371 Length of database: 386 Length adjustment: 30 Effective length of query: 341 Effective length of database: 356 Effective search space: 121396 Effective search space used: 121396 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory