Align ABC-type maltose transport, ATP binding protein (characterized, see rationale)
to candidate WP_017177725.1 A1QA_RS0104460 ABC transporter ATP-binding protein
Query= uniprot:Q6MNM2 (347 letters) >NCBI__GCF_000295095.1:WP_017177725.1 Length = 372 Score = 154 bits (389), Expect = 3e-42 Identities = 85/222 (38%), Positives = 130/222 (58%), Gaps = 2/222 (0%) Query: 14 GSADVLKGIDLDIAPGEFLVLVGPSGCGKSTLLRTLAGLESADSGTISIDGKKINDIEPQ 73 G + G+DL+I G + L+G SG GKS+LLR +AGLE +G+I DG+ + Sbjct: 21 GPVVAVDGVDLEIPAGRIVALLGASGSGKSSLLRAVAGLEPVAAGSIRWDGRDVVGTPVH 80 Query: 74 NRDIAMVFQSYALYPHMTVAENMGFGLKLKNLAAAEITKRVNEISELLQIKHLLDRKPKE 133 R ++FQ L+P V N+ +GL L AE +RV E+ EL+ + R Sbjct: 81 RRGFGLMFQEGQLFPFRDVGGNVAYGLT--GLPRAERARRVAEMLELVGLPGYGPRPITT 138 Query: 134 LSGGQRQRVALGRALSRQTPVILFDEPLSNLDAHLRSQMRLEIKRLHHNSKSTMIYVTHD 193 LSGGQ QRVAL RAL+ + ++L DEPLS LD LR Q+ ++++ + +T +YVTHD Sbjct: 139 LSGGQAQRVALARALAPRPRLLLLDEPLSALDRALREQLAVDLRAILAEQGTTALYVTHD 198 Query: 194 QMEATTLGDRIAVLKDGVIEQIGTPSEIYHRPKNTFIATFIG 235 Q EA T+ D + V++ G + ++ P+E++ P + +A F+G Sbjct: 199 QDEAMTVADEVGVMEAGRLARLAAPAELWADPGSASVAAFLG 240 Lambda K H 0.318 0.136 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 284 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 347 Length of database: 372 Length adjustment: 29 Effective length of query: 318 Effective length of database: 343 Effective search space: 109074 Effective search space used: 109074 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory