Align ABC-type maltose transport, ATP binding protein (characterized, see rationale)
to candidate WP_017177778.1 A1QA_RS0104755 ABC transporter ATP-binding protein
Query= uniprot:Q6MNM2 (347 letters) >NCBI__GCF_000295095.1:WP_017177778.1 Length = 386 Score = 240 bits (613), Expect = 4e-68 Identities = 120/222 (54%), Positives = 155/222 (69%), Gaps = 2/222 (0%) Query: 21 GIDLDIAPGEFLVLVGPSGCGKSTLLRTLAGLESADSGTISIDGKKINDIEPQNRDIAMV 80 G+ LDIAPGEF+ L+GPSGCGK+T LR +AG E SG + +DG+ + + P R ++MV Sbjct: 40 GVSLDIAPGEFVTLLGPSGCGKTTTLRMIAGFEDTTSGQVVLDGQNMVSLPPNKRPMSMV 99 Query: 81 FQSYALYPHMTVAENMGFGLKLKNLAAAEITKRVNEISELLQIKHLLDRKPKELSGGQRQ 140 FQSYAL+PH++V EN+ +GLKL++ EI ++V + + L DR P ELSGGQ+Q Sbjct: 100 FQSYALFPHLSVRENIAYGLKLRHTKPEEIREQVEIALTSMNLNSLADRAPNELSGGQQQ 159 Query: 141 RVALGRALSRQTPVILFDEPLSNLDAHLRSQMRLEIKRLHHNSKSTMIYVTHDQMEATTL 200 RVAL RA+ + V+LFDEPLSNLDA LR +MRLEI+RL T IYVTHDQ EA T+ Sbjct: 160 RVALARAMVMRPKVLLFDEPLSNLDAKLRVRMRLEIRRLQQRMGITSIYVTHDQAEAMTM 219 Query: 201 GDRIAVLKDGVIEQIGTPSEIYHRPKNTFIATFIGSPEMNFL 242 DRI V+ G IEQ+ TP +IY RP + F+A FIG NFL Sbjct: 220 SDRIVVMNAGTIEQVATPEKIYRRPASVFVADFIG--RANFL 259 Lambda K H 0.318 0.136 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 317 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 347 Length of database: 386 Length adjustment: 30 Effective length of query: 317 Effective length of database: 356 Effective search space: 112852 Effective search space used: 112852 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory