Align MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized)
to candidate WP_017177778.1 A1QA_RS0104755 ABC transporter ATP-binding protein
Query= TCDB::Q8DT25 (377 letters) >NCBI__GCF_000295095.1:WP_017177778.1 Length = 386 Score = 246 bits (627), Expect = 1e-69 Identities = 141/306 (46%), Positives = 190/306 (62%), Gaps = 30/306 (9%) Query: 4 LKLDNIYKRYPNAKH--YSVENFNLDIHDKEFIVFVGPSGCGKSTTLRMIAGLEDITEGN 61 L+L ++ K + N Y+V +LDI EF+ +GPSGCGK+TTLRMIAG ED T G Sbjct: 19 LELRDVVKVFSNRGKDVYAVHGVSLDIAPGEFVTLLGPSGCGKTTTLRMIAGFEDTTSGQ 78 Query: 62 LYIDDKLMNDASPKDRDIAMVFQNYALYPHMSVYENMAFGLKLRKYKKDDINKRVHEAAE 121 + +D + M P R ++MVFQ+YAL+PH+SV EN+A+GLKLR K ++I ++V A Sbjct: 79 VVLDGQNMVSLPPNKRPMSMVFQSYALFPHLSVRENIAYGLKLRHTKPEEIREQVEIALT 138 Query: 122 ILGLTEFLERKPADLSGGQRQRVAMGRAIVRDAKVFLMDEPLSNLDAKLRVAMRAEIAKI 181 + L +R P +LSGGQ+QRVA+ RA+V KV L DEPLSNLDAKLRV MR EI ++ Sbjct: 139 SMNLNSLADRAPNELSGGQQQRVALARAMVMRPKVLLFDEPLSNLDAKLRVRMRLEIRRL 198 Query: 182 HRRIGATTIYVTHDQTEAMTLADRIVIMSATPNPDKTGSIGRIEQIGTPQELYNEPANKF 241 +R+G T+IYVTHDQ EAMT++DRIV+M+A G IEQ+ TP+++Y PA+ F Sbjct: 199 QQRMGITSIYVTHDQAEAMTMSDRIVVMNA----------GTIEQVATPEKIYRRPASVF 248 Query: 242 VAGFIGSPAMNFFEVTVE-------KERLVNQDGLSLALPQGQEKILEEKGYLGKKVTLG 294 VA FIG NF T R++ D L A +G G VT+ Sbjct: 249 VADFIG--RANFLAATARDVGGGRCSARVLGAD-LQAACHEGVS--------AGSGVTVI 297 Query: 295 IRPEDI 300 +RPE + Sbjct: 298 VRPESV 303 Score = 26.2 bits (56), Expect = 0.002 Identities = 23/113 (20%), Positives = 41/113 (36%), Gaps = 10/113 (8%) Query: 120 AEILGLTEFLERKPADLSGGQRQRVAMGRAIVR----------DAKVFLMDEPLSNLDAK 169 A+ +G FL D+ GG+ +G + V + E + Sbjct: 250 ADFIGRANFLAATARDVGGGRCSARVLGADLQAACHEGVSAGSGVTVIVRPESVRLSPGT 309 Query: 170 LRVAMRAEIAKIHRRIGATTIYVTHDQTEAMTLADRIVIMSATPNPDKTGSIG 222 A +E+ H R+ ++ Y H + E T A I+ + + P P + G Sbjct: 310 GEGAGGSELVGAHGRVLSSVFYGDHVEYEVETEAGTILCVESDPEPSSVHAEG 362 Lambda K H 0.318 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 367 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 377 Length of database: 386 Length adjustment: 30 Effective length of query: 347 Effective length of database: 356 Effective search space: 123532 Effective search space used: 123532 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory