Align Aromatic amino acid transport protein AroP (characterized, see rationale)
to candidate WP_017177889.1 A1QA_RS0105330 amino acid permease
Query= uniprot:A0A0C4YP23 (465 letters) >NCBI__GCF_000295095.1:WP_017177889.1 Length = 479 Score = 327 bits (837), Expect = 7e-94 Identities = 172/443 (38%), Positives = 266/443 (60%), Gaps = 10/443 (2%) Query: 13 LKRGLKNRHIQLIALGGAIGTGLFLGIAQTIKMAGPSVLLGYAVAGIIAFFIMRQLGEMV 72 L+R L NRHIQLIA+GGAIGTGLF+G +TI +AGP VLL YA+ G F +MR LGE++ Sbjct: 20 LQRRLTNRHIQLIAIGGAIGTGLFMGSGKTISLAGPGVLLVYAIIGGFLFLVMRALGEVL 79 Query: 73 VDEPVAGSFSHFANKYCGSFAGFMSGWNYWVLYILVSMAELSAVGIYVQYWWPHIPTWAS 132 + SF+ A+ G +AGF +GW Y+ +++ ++AE+ A+ YVQ+WWP +P W Sbjct: 80 LSNLEYKSFADVAHDLIGPWAGFFTGWTYYFCWLVTAIAEVIAITQYVQHWWPTVPLWLP 139 Query: 133 ALGFFLLINAINLTSVKSFGEMEFWFSIVKVLAIVGMIVFGGYLLASGTAGPQASVSNLW 192 A L+ ++NLT+V++FGE+EFWFSI+K++AI+ ++V G L+ G P +V++L Sbjct: 140 ATVTVALLLSLNLTTVRAFGEIEFWFSIIKIVAILALVVVGIVLVVIGFTAPNGAVASLG 199 Query: 193 Q-------HGGFFPNGISGLVMAMAVIMFSFGGLELVGITAAEADEPEKTIPKATNQVIY 245 G FPNG SG A + +F+F G EL+G AAEA +PE T+PKA N + Sbjct: 200 NLGDLSDPVGSLFPNGFSGFTGAFQIAVFAFVGTELIGTAAAEAKDPEVTLPKAINAIPV 259 Query: 246 RILIFYVGALGVLLSLYPWEKVVTGGSPFVLIFHAMNSDIVATVLNAVVLTAALSVYNSG 305 RIL+FY+GAL ++ + PW + VT SPFV +F + A+++N VVLTAA S NSG Sbjct: 260 RILLFYLGALTAIMMVTPWRE-VTESSPFVAMFSLAGFGLAASLVNFVVLTAAASSANSG 318 Query: 306 VYCNSRMLFGLAKQGNAPKALLKVNKRGIPLAALGVSALATAACVVINYFMPG--EAFEL 363 +Y SRML+GL+ + P ++ R +P AL V+ A + + Y +AF + Sbjct: 319 MYSTSRMLYGLSWSEHGPAVFKRLTSRSVPGPALVVTCAALLTAIPLLYTTSSIIDAFTV 378 Query: 364 LMGLVVSALIINWAMISIIHLKFRRDKRAAGQETRFKSLGYPLTNYVCLAFLAGILYVMY 423 + + I+ W +I + +L+FR + + FK G ++ + + F A +++ + Sbjct: 379 VTTVASVLFILVWIIIVVSYLRFRSLHPERHEASAFKMPGDRVSAWASIVFFAFVVWTLI 438 Query: 424 LTPGLRISVYLIPAWLAVLGLSY 446 R++V + P WL V+ ++ Sbjct: 439 QAEDTRLAVLVSPLWLVVMASAW 461 Lambda K H 0.326 0.140 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 545 Number of extensions: 25 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 465 Length of database: 479 Length adjustment: 33 Effective length of query: 432 Effective length of database: 446 Effective search space: 192672 Effective search space used: 192672 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory