Align NatA aka BRAF aka SLR0467, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized)
to candidate WP_017177032.1 A1QA_RS0100780 ABC transporter ATP-binding protein
Query= TCDB::Q55164 (267 letters) >NCBI__GCF_000295095.1:WP_017177032.1 Length = 328 Score = 83.6 bits (205), Expect = 5e-21 Identities = 73/246 (29%), Positives = 107/246 (43%), Gaps = 27/246 (10%) Query: 13 SPESSLLLA---QGLSKSFGGLRAVDHADIVVKEGSITGLIGPNGAGKTTLFNLLSNFIR 69 SP+ SL A GL K+FG +RAVD D+ V G I +GPNGAGK+T +++ F Sbjct: 14 SPDPSLAPAVEVAGLVKTFGPVRAVDGIDLRVAPGEIVAFLGPNGAGKSTALDVILGFST 73 Query: 70 PDQGEVLFNGDSIGQLAPHQIALRGSVRTFQVAKVLSRLTVLENMLLADQHQTGEKFLPR 129 PD G G LAP Q A R + +L E LL D T + + Sbjct: 74 PDAGSARVFG-----LAPAQAA-----RELRTGAILQ-----EGGLLPD--YTVRQTITA 116 Query: 130 LINFRRVQKEERANREKAMAMLESVGLGAKAQDYAGALSGGQRKLLEMARALMSNPKLIL 189 + R R A+ E G+ SGG+R+ L +A AL+ NP L++ Sbjct: 117 VAAM-------RGARHDIPAVEELAGISPILGRKVVKCSGGERQRLRLALALLGNPDLMV 169 Query: 190 LDEPAAGVNPTLIGQICEHIVNWNRQGITFLVIEHNMDVIMTLCHHVWVLAEGRNLADGT 249 LDEP AG++ T I L H + + ++ GR +A G+ Sbjct: 170 LDEPTAGMDVTARRSFWAAIRERAAGNKAVLFATHYLQEAADFADRIVIINRGRIIASGS 229 Query: 250 PEQIQS 255 + +++ Sbjct: 230 VDDVRA 235 Lambda K H 0.319 0.136 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 186 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 328 Length adjustment: 26 Effective length of query: 241 Effective length of database: 302 Effective search space: 72782 Effective search space used: 72782 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory