Align ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized)
to candidate WP_017177453.1 A1QA_RS0103020 ABC transporter ATP-binding protein
Query= reanno::Smeli:SMc03065 (362 letters) >NCBI__GCF_000295095.1:WP_017177453.1 Length = 300 Score = 144 bits (364), Expect = 2e-39 Identities = 88/217 (40%), Positives = 123/217 (56%), Gaps = 8/217 (3%) Query: 15 AVDVIHGIDLDIKEGEFVVFVGPSGCGKSTLLRMIAGLEEITGGDMFIDGERVNDVPPSK 74 ++ V+ + L I G+FV VG SGCGKST+LR++AGLE + G + +DGER+ P + Sbjct: 73 SLHVLDDVTLTIPPGQFVAVVGQSGCGKSTILRLLAGLETPSQGSVVVDGERITRPAPER 132 Query: 75 RGIAMVFQSYALYPHMTVYDNMAFGMRIARESKEEIDRRVRGAADMLQLTPYLDRLPKAL 134 AM FQ L P TV DN+A G + AR RR+ A +++ L + P L Sbjct: 133 ---AMAFQDATLLPWRTVRDNVALGPQ-ARGRLAIDQRRIDAALEIVGLRDFAGAYPSTL 188 Query: 135 SGGQRQRVAIGRAICRNPKVFLFDEPLSNLDAALRVATRIEIAKLSERMSDTTMIYVTHD 194 SGG QR A+ RA+ P++FL DEP LDA R+ + E A+L + T I VTHD Sbjct: 189 SGGMAQRAALARALVNRPRLFLLDEPFGKLDALTRLGLQDEFARLWSSQA-FTAILVTHD 247 Query: 195 QVEAMTLADRIVVLS---AGHIEQVGAPLELYERPAN 228 EA+ LA+R+VVLS A + + P L + PA+ Sbjct: 248 VDEALRLAERVVVLSERPAHVVADLEVPAALADAPAS 284 Lambda K H 0.320 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 242 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 300 Length adjustment: 28 Effective length of query: 334 Effective length of database: 272 Effective search space: 90848 Effective search space used: 90848 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory