Align ABC transporter for D-Galactose and D-Glucose, permease component 1 (characterized)
to candidate WP_017177537.1 A1QA_RS0103470 sugar ABC transporter permease
Query= reanno::pseudo13_GW456_L13:PfGW456L13_1895 (302 letters) >NCBI__GCF_000295095.1:WP_017177537.1 Length = 279 Score = 115 bits (289), Expect = 9e-31 Identities = 84/284 (29%), Positives = 149/284 (52%), Gaps = 24/284 (8%) Query: 15 ALQRWLPKLVLAPSMLIVLVGFYGYIIWTFILSFTNSSFMPSYKWVGLQQYMRLMDNDRW 74 AL+++ P + P++L L+ F LSFT + + KWVGL+ Y +++D+D Sbjct: 4 ALKKYFP-IFAGPTLLAFLIAFLVPFFMGLYLSFTKFKTLTNAKWVGLENYSKVLDSD-- 60 Query: 75 WVASKNLALFGGMFISISLVLGVF-LAVLLDQRIRKEGFIRTVYLYPMALSMIVTGTAWK 133 + ++ + + I++ LG F LA LL ++++ F R+V+ P + IV G W+ Sbjct: 61 FGSALWFTVIVSVISIITVNLGAFTLAYLLTRKLKGTNFFRSVFFMPNLIGGIVLGFTWQ 120 Query: 134 WLLNPGLGLDKMLRDWGWEGFRLDWLVDQDRVVYCLVIAAVWQASGFVMAMFLAGLRGVD 193 +LN +L+ WG + DW + + L++ WQ G++M +++AGL+ V Sbjct: 121 VMLNA------ILKHWG-QTIVNDWHLG----LLGLILLVNWQLMGYMMIIYIAGLQNVP 169 Query: 194 QSIIRAAQVDGAS----LPTIYLKIVLPSLRPVFFSAFMILAHIAIKSFDLVAAMTAGGP 249 +I AAQ+DGAS L + + +V+PS + F+ LA+ K FD A+T G P Sbjct: 170 PELIEAAQIDGASGWLTLRNVTIPMVMPS---ITICLFLTLAN-TFKMFDQNLALTNGAP 225 Query: 250 GYSSDLPAMFMYSFTF-SRGQMGIGSASAMLMLGAVLTILVPYL 292 +++ A+ +Y+ + +R QMG A+A++ V I + L Sbjct: 226 LKQTEMAALSIYNTMYHARNQMGQAQAAAVIFFLIVAAIALVQL 269 Lambda K H 0.329 0.141 0.448 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 239 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 302 Length of database: 279 Length adjustment: 26 Effective length of query: 276 Effective length of database: 253 Effective search space: 69828 Effective search space used: 69828 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory