Align ABC transporter (characterized, see rationale)
to candidate WP_017177725.1 A1QA_RS0104460 ABC transporter ATP-binding protein
Query= uniprot:A0A166QFW2 (381 letters) >NCBI__GCF_000295095.1:WP_017177725.1 Length = 372 Score = 163 bits (412), Expect = 8e-45 Identities = 96/219 (43%), Positives = 132/219 (60%), Gaps = 12/219 (5%) Query: 22 VSLEIAAGEFVVFVGPSGCGKSTLLRLIAGLDSICGGDLLIDGRRVNDLEPRERGVGMVF 81 V LEI AG V +G SG GKS+LLR +AGL+ + G + DGR V RG G++F Sbjct: 29 VDLEIPAGRIVALLGASGSGKSSLLRAVAGLEPVAAGSIRWDGRDVVGTPVHRRGFGLMF 88 Query: 82 QSYALYPHMSVYDNISFGLKLAKTDKTSL--RERVLKTAQILQLDKLLQRKPKE---LSG 136 Q L+P V N+++GL T L ER + A++L+L L P+ LSG Sbjct: 89 QEGQLFPFRDVGGNVAYGL-------TGLPRAERARRVAEMLELVGLPGYGPRPITTLSG 141 Query: 137 GQRQRVAMGRAMAREPDILLFDEPLSNLDASLRVQMRNEIARLHDRLGSTMIYVTHDQVE 196 GQ QRVA+ RA+A P +LL DEPLS LD +LR Q+ ++ + G+T +YVTHDQ E Sbjct: 142 GQAQRVALARALAPRPRLLLLDEPLSALDRALREQLAVDLRAILAEQGTTALYVTHDQDE 201 Query: 197 AMTLADKIVVLNGGRVEQVGSPRELYERPASRFVAGFLG 235 AMT+AD++ V+ GR+ ++ +P EL+ P S VA FLG Sbjct: 202 AMTVADEVGVMEAGRLARLAAPAELWADPGSASVAAFLG 240 Lambda K H 0.320 0.137 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 339 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 381 Length of database: 372 Length adjustment: 30 Effective length of query: 351 Effective length of database: 342 Effective search space: 120042 Effective search space used: 120042 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory