Align Serine uptake transporter, SerP1, of 259 aas and 12 TMSs (Trip et al. 2013). L-serine is the highest affinity substrate (Km = 18 μM), but SerP1 also transports L-threonine and L-cysteine (Km values = 20 - 40 μM) (characterized)
to candidate WP_043508004.1 A1QA_RS0103780 amino acid permease
Query= TCDB::F2HQ25 (459 letters) >NCBI__GCF_000295095.1:WP_043508004.1 Length = 489 Score = 221 bits (562), Expect = 5e-62 Identities = 125/350 (35%), Positives = 197/350 (56%), Gaps = 12/350 (3%) Query: 14 LQNRHIQLIAIAGTIGTGLFLGAGKTIQMTGPSVIFAYILIGIAMFFFLRTIGEMLYNDP 73 L+NRH+Q+IAI G+IGTGLFLGAG + G +I AY + G+ F +R +GE+ P Sbjct: 28 LKNRHLQMIAIGGSIGTGLFLGAGGRLAQGGAILIVAYAICGVFAFLMVRALGELAIRRP 87 Query: 74 SQHSFLNFVTKYSGVRTGYFTQWSYWLVIVFVCISELTAIGTYIQFW--LPQVPLWLIEI 131 S +F+++ ++ G + Y T W ++L ++++TA+ Y+ +W VP W++ + Sbjct: 88 SSGAFVSYAREFLGEKGAYITGWFFFLDWAVTVMADITAVALYLHYWGTFKAVPQWVLAL 147 Query: 132 VMLALLFGLNTLNSRFFGETEFWFAMIKVAAIIGMIVTAIILVAGNFHYSTVLSGKTVHD 191 + LAL+F LN LN + FGE EFWFA+IKVAAI+ ++ AI ++ V K Sbjct: 148 IALALVFVLNMLNVKMFGEAEFWFALIKVAAIVSFMLVAI--------WAIVSGAKVGGG 199 Query: 192 SASLSNIFDGFQLFPHGAWNFVGALQMVMFAFTSMEFIGMTAAETVNPKKSLPKAINQIP 251 +A L NI + P G V+FAF E +G+ A E + LPKAIN + Sbjct: 200 AAGLGNITEHGGFAPAGIGVVFTLTLGVVFAFGGTEMVGVAAGEAKDAITVLPKAINSMI 259 Query: 252 VRILLFYVGALLAIMAIFNWHYIPADKSPFVMVFQLIGIKWAAALINFVVLTSAASALNS 311 +RI +FYVG++L + + + ++SPFV F IG+ A +I VVLT+A S+LN+ Sbjct: 260 LRIFVFYVGSVLLMAFVLPYTSYSKNESPFVTFFSGIGVPHAGDIIQVVVLTAALSSLNA 319 Query: 312 SLFSATRNMYSLAQQHDKGRLTPFTKLSKAGIPINALYMATALSLLAPVL 361 L++ R + S+A + + L+K +P A+ + +AL L+ L Sbjct: 320 GLYATGRTLRSMAVAGEAPSVA--AGLNKHQVPAGAIAITSALGLVGVAL 367 Lambda K H 0.329 0.141 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 595 Number of extensions: 41 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 459 Length of database: 489 Length adjustment: 33 Effective length of query: 426 Effective length of database: 456 Effective search space: 194256 Effective search space used: 194256 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory