Align TreV, component of Trehalose porter (characterized)
to candidate WP_017177725.1 A1QA_RS0104460 ABC transporter ATP-binding protein
Query= TCDB::Q97ZC0 (324 letters) >NCBI__GCF_000295095.1:WP_017177725.1 Length = 372 Score = 156 bits (394), Expect = 9e-43 Identities = 92/260 (35%), Positives = 143/260 (55%), Gaps = 15/260 (5%) Query: 13 GKNIVINGITEKIETGEFFVILGPSGEGKSTLLKILAGIEKLDKGKIIADGADITDKPPE 72 G + ++G+ +I G +LG SG GKS+LL+ +AG+E + G I DG D+ P Sbjct: 21 GPVVAVDGVDLEIPAGRIVALLGASGSGKSSLLRAVAGLEPVAAGSIRWDGRDVVGTPVH 80 Query: 73 KRNVAMVFQNYALYPNMSVRDNIAFPLKMRGMKKEEIIERVEKAAKLLGISEILDKKVTQ 132 +R ++FQ L+P V N+A+ L G+ + E RV + +L+G+ + +T Sbjct: 81 RRGFGLMFQEGQLFPFRDVGGNVAYGLT--GLPRAERARRVAEMLELVGLPGYGPRPITT 138 Query: 133 ISGGQQQRVALARAIVRNPSYFLLDEPLSNLDARVRTTARGELKRIQKELKGTFIYVTHD 192 +SGGQ QRVALARA+ P LLDEPLS LD +R +L+ I E T +YVTHD Sbjct: 139 LSGGQAQRVALARALAPRPRLLLLDEPLSALDRALREQLAVDLRAILAEQGTTALYVTHD 198 Query: 193 QKEALSLADRIAILHKGKFEQVSDPKTLYEYPKTKWVAQFVGEFPMNFLPGELMKEKAQE 252 Q EA+++AD + ++ G+ +++ P L+ P + VA F+G P+ L +E+ + Sbjct: 199 QDEAMTVADEVGVMEAGRLARLAAPAELWADPGSASVAAFLGFGPI------LTREQTEA 252 Query: 253 IGF-------RPEWVEVGKG 265 +G+ RP E G G Sbjct: 253 LGWAVLLDGGRPGAREAGSG 272 Lambda K H 0.318 0.137 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 258 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 324 Length of database: 372 Length adjustment: 29 Effective length of query: 295 Effective length of database: 343 Effective search space: 101185 Effective search space used: 101185 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory