Align TreV, component of Trehalose porter (characterized)
to candidate WP_017177778.1 A1QA_RS0104755 ABC transporter ATP-binding protein
Query= TCDB::Q97ZC0 (324 letters) >NCBI__GCF_000295095.1:WP_017177778.1 Length = 386 Score = 224 bits (572), Expect = 2e-63 Identities = 114/243 (46%), Positives = 171/243 (70%), Gaps = 6/243 (2%) Query: 3 VELIDIVKKY---GKNI-VINGITEKIETGEFFVILGPSGEGKSTLLKILAGIEKLDKGK 58 +EL D+VK + GK++ ++G++ I GEF +LGPSG GK+T L+++AG E G+ Sbjct: 19 LELRDVVKVFSNRGKDVYAVHGVSLDIAPGEFVTLLGPSGCGKTTTLRMIAGFEDTTSGQ 78 Query: 59 IIADGADITDKPPEKRNVAMVFQNYALYPNMSVRDNIAFPLKMRGMKKEEIIERVEKAAK 118 ++ DG ++ PP KR ++MVFQ+YAL+P++SVR+NIA+ LK+R K EEI E+VE A Sbjct: 79 VVLDGQNMVSLPPNKRPMSMVFQSYALFPHLSVRENIAYGLKLRHTKPEEIREQVEIALT 138 Query: 119 LLGISEILDKKVTQISGGQQQRVALARAIVRNPSYFLLDEPLSNLDARVRTTARGELKRI 178 + ++ + D+ ++SGGQQQRVALARA+V P L DEPLSNLDA++R R E++R+ Sbjct: 139 SMNLNSLADRAPNELSGGQQQRVALARAMVMRPKVLLFDEPLSNLDAKLRVRMRLEIRRL 198 Query: 179 QKELKGTFIYVTHDQKEALSLADRIAILHKGKFEQVSDPKTLYEYPKTKWVAQFVGEFPM 238 Q+ + T IYVTHDQ EA++++DRI +++ G EQV+ P+ +Y P + +VA F+G Sbjct: 199 QQRMGITSIYVTHDQAEAMTMSDRIVVMNAGTIEQVATPEKIYRRPASVFVADFIGR--A 256 Query: 239 NFL 241 NFL Sbjct: 257 NFL 259 Lambda K H 0.318 0.137 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 308 Number of extensions: 12 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 324 Length of database: 386 Length adjustment: 29 Effective length of query: 295 Effective length of database: 357 Effective search space: 105315 Effective search space used: 105315 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory