Align Aromatic amino acid:H+ symporter, AroP of 457 aas and 12 TMSs (Cosgriff and Pittard 1997). Transports phenylalanine, tyrosine and tryptophan (characterized)
to candidate WP_017178492.1 A1QA_RS0108530 amino acid permease
Query= TCDB::P15993 (457 letters) >NCBI__GCF_000295095.1:WP_017178492.1 Length = 493 Score = 294 bits (752), Expect = 5e-84 Identities = 160/445 (35%), Positives = 255/445 (57%), Gaps = 15/445 (3%) Query: 5 QQHGEQLKRGLKNRHIQLIALGGAIGTGLFLGSASVIQSAGPG-IILGYAIAGFIAFLIM 63 Q ++L+R L +RH+ +I++GGAIGTGLF+ S + I AGPG ++ YA G + +LIM Sbjct: 16 QSEPQELRRSLLSRHLTMISIGGAIGTGLFVASGATISQAGPGGALVAYAAVGIMVWLIM 75 Query: 64 RQLGEMVVEEPVAGSFSHFAYKYWGSFAGFASGWNYWVLYVLVAMAELTAVGKYIQFWYP 123 + LGEM PVAGSF + ++ GFA GWNYW + + AEL A +++W P Sbjct: 76 QSLGEMAAYLPVAGSFGEYGTRFVSPSFGFAIGWNYWFNWAITVAAELVAAALVMKYWLP 135 Query: 124 EIPTWVSAAVFFVVINAINLTNVKVFGEMEFWFAIIKVIAVVAMIIFGGWLLFSGNGGPQ 183 ++P+ V +A+F V++ IN + + +GE EF FA IKV+AV+ +I G ++ GGP Sbjct: 136 DVPSLVWSALFLVILFTINALSARAYGESEFLFASIKVVAVIVFLILGVAMIAGILGGPS 195 Query: 184 ATVSNLWDQGGFLPHGFTGLVMMMAIIMFSFGGLELVGITAAEADNPEQSIPKATNQVIY 243 N G G+++++ + +SF G EL+G A EA+NPE++IP+A + + Sbjct: 196 PGTENWTTGEAPFVGGGEGILLVLLVAGYSFQGTELIGTAAGEAENPERTIPRAIRTIFW 255 Query: 244 RILIFYIGSLAVLLSLMPWT--------RVTADTSPFVLIFHELGDTFVANALNIVVLTA 295 RIL+FYIG++AV+ L+P+T SPF L+F G A+ +N ++LT+ Sbjct: 256 RILLFYIGAIAVIGFLIPYTDPNLLNSAEDNVSVSPFTLVFERAGILGAASVINAIILTS 315 Query: 296 ALSVYNSCVYCNSRMLFGLAQQGNAPKALASVDKRGVPVNTILVSALVTALCVLINYLAP 355 LS S +Y ++RMLF LA++G+AP+ L + VP+N ++ + LV + + + Sbjct: 316 VLSAGTSGLYSSTRMLFALAERGHAPRFLTRLSSHQVPMNALVATTLVGLAGFITSLVGD 375 Query: 356 ESAFGLLMALVVSALVINWAMISLAHMKFRRAKQEQG-VVTRFP--ALLYPLGNWICLLF 412 +A+ L+ L A I WA IS H +FR A + QG +T P A +P G + L+ Sbjct: 376 GAAYEFLLTLSALAGFITWAGISWCHWRFRMALKAQGQPLTDLPYRARFFPAGAIVALIA 435 Query: 413 MAAVLVIML---MTPGMAISVYLIP 434 A+++ +T G ++ L+P Sbjct: 436 CIAIIIGQAYGPVTSGKSLGEILMP 460 Lambda K H 0.328 0.141 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 566 Number of extensions: 23 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 457 Length of database: 493 Length adjustment: 33 Effective length of query: 424 Effective length of database: 460 Effective search space: 195040 Effective search space used: 195040 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory