Align 3-hydroxypropionyl-CoA dehydratase (EC 4.2.1.116) (characterized)
to candidate WP_017178971.1 A1QA_RS0111065 1,4-dihydroxy-2-naphthoyl-CoA synthase
Query= BRENDA::A4YI89 (259 letters) >NCBI__GCF_000295095.1:WP_017178971.1 Length = 381 Score = 87.0 bits (214), Expect = 5e-22 Identities = 76/296 (25%), Positives = 124/296 (41%), Gaps = 63/296 (21%) Query: 17 ITLNRPDKLNALNAKLLEELDRAVSQAESDPEIRVIIITGKGK-------AFCAGAD--- 66 + ++RP+ NA + ++EL + A ++ +I+TG G AF +G D Sbjct: 82 VAIDRPEVRNAFRPRTVDELAAVLDHARMSGDVGAVILTGNGPSPRDGGWAFSSGGDQRI 141 Query: 67 --------------------------ITQFNQLTPAEAWKF-------------SKKGR- 86 + P+E + ++ GR Sbjct: 142 RGRDGYLYETDDDASGAGGPTSSGASAEGGSGAAPSEPYSHEADVAAARARTDAARAGRL 201 Query: 87 ---EIMDKIEALSKPTIAMINGYALGGGLELALACDIRIAA-EEAQLGLPEINLGIYPGY 142 E+ I + K IA ++G+A GGG L + CD+ +A+ E A + N+G + Sbjct: 202 HILEVQRLIRMMPKVVIAAVSGWAAGGGHSLNVICDLSLASIEHALFKQTDANVGSFDAG 261 Query: 143 GGTQRLTRVIGKGRALEMMMTGDRIPGKDAEKYGLVNRVVPLANLEQETRKLAEKIAKKS 202 G+ L R G RA E+ AE++G+VN VP A LE+ + A +A KS Sbjct: 262 YGSALLARQCGDKRAREIFFLARPYDAATAERWGVVNEAVPHAELEERALEYAAIVASKS 321 Query: 203 PISLALIKEVVNRGLDSPLLSGLALESVGWG----VVFSTEDKKEGVSAFLEKREP 254 P ++ ++K N D GLA + V G + + T++ EG AFL +REP Sbjct: 322 PQAIRMLKYAFNLADD-----GLAGQQVFAGEATRLAYMTDEAVEGRDAFLARREP 372 Lambda K H 0.315 0.135 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 164 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 259 Length of database: 381 Length adjustment: 27 Effective length of query: 232 Effective length of database: 354 Effective search space: 82128 Effective search space used: 82128 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory