Align dihydrolipoyl dehydrogenase (EC 1.8.1.4) (characterized)
to candidate WP_017178483.1 A1QA_RS0108485 FAD-dependent oxidoreductase
Query= BRENDA::Q04829 (475 letters) >NCBI__GCF_000295095.1:WP_017178483.1 Length = 483 Score = 268 bits (684), Expect = 4e-76 Identities = 163/460 (35%), Positives = 243/460 (52%), Gaps = 18/460 (3%) Query: 11 ELLVIGAGPGGYVAAIRAAQNGIDTTLVEKDAYGGTCLNYGCIPSKALITGANLAHEAGN 70 +LLV+G G G A+ A+ G +VE+D GGTC+N CIP+K LI+ A + E Sbjct: 22 DLLVVGGGKAGKSLAMLRAKAGDKVVMVERDKVGGTCINVACIPTKTLISAARVLREVQG 81 Query: 71 AEEMGIH-----------ADPVVDMSQLRDWKSGVVDQLTGGVEKLCKANGVNLVEGTAR 119 ++ G+ A ++++ R K VV + EK+ A+G++ V+GTAR Sbjct: 82 SQAYGVTLSEQDGGAGALAQARIELASFRARKEAVVGGMVAAHEKMFPASGMDFVKGTAR 141 Query: 120 FKDENAVRIAHGGEGQGSETIEFEHCIIATGSRVIQIPGFD-FGDEPVWSSRDALEADTV 178 F E V IA G + +I TG+ +P + D W+S D L + Sbjct: 142 FVGERTVEIALNDGGL--RRVRGAKVLINTGTTP-SVPSIEGLSDVRYWTSEDLLTLPEL 198 Query: 179 PERLVVVGGGYIGMELSTTFAKLGADVTVVEMLDDILPGYESDVARVVRKRAEELGIDMH 238 P L+V+GGG IG+E+++ LG VT+V IL + DVA V E LG+ + Sbjct: 199 PSSLIVLGGGVIGVEMASLMGLLGVPVTIVHAGPHILDREDEDVAAEVTAGLEALGVTVL 258 Query: 239 LGEGASGWREEDDGIMVTTETEDGEENEYRADKVLVAVGRSPVTDTMDIENAGLEADDRG 298 G AS DG V T DG +E +LVA+GR+PVT + +E AG+E +RG Sbjct: 259 AGAPASKVAAAADGNGVVVTTADG--HEVSGSHLLVALGRTPVTAGLGLEAAGVELTERG 316 Query: 299 FLSVDDRRRTDVEHIYAVGDVVEDTPMLAHVASKEGIVAAEHVAGEPVAFDSQAVPAAVF 358 F+ VDD RT E+++A GDV TP H + + V + AG+ + + +P AVF Sbjct: 317 FVRVDDHLRTTAENVFAAGDVA-GTPQFTHASWNDFRVLRDLFAGKEASTTGRLIPWAVF 375 Query: 359 TDPEIGTVGMTEADAEEAGFTPVVGQMPFRASGRALTTNHADGFVRVVADEESGFVLGAQ 418 T PE+G VG++EA+A EAG+ V + P A RA T H +GF +V+ D + +LGA Sbjct: 376 TTPELGHVGLSEAEAREAGYEVRVAKTPTAAVPRAKTLGHTEGFFKVIIDARTDLILGAA 435 Query: 419 IVGPEASELIAELAFAIEMGATLEDVASTIHTHPTLAEAV 458 I+G EASE++ + A+ T + V + THPT++E + Sbjct: 436 IIGAEASEVVTSIQMAMLGDLTWQQVRDAVITHPTMSEGL 475 Lambda K H 0.315 0.134 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 673 Number of extensions: 46 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 475 Length of database: 483 Length adjustment: 34 Effective length of query: 441 Effective length of database: 449 Effective search space: 198009 Effective search space used: 198009 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory