Align ABC-type sugar transport system, ATPase component protein (characterized, see rationale)
to candidate WP_017177725.1 A1QA_RS0104460 ABC transporter ATP-binding protein
Query= uniprot:D8IPI1 (406 letters) >NCBI__GCF_000295095.1:WP_017177725.1 Length = 372 Score = 167 bits (423), Expect = 5e-46 Identities = 97/223 (43%), Positives = 130/223 (58%), Gaps = 2/223 (0%) Query: 14 AGGPPVLHPLDLHIGDGEFVVLLGPSGCGKSTMLRMIAGLEDISGGTLRIGGTVVNDLPA 73 AG + +DL I G V LLG SG GKS++LR +AGLE ++ G++R G V P Sbjct: 20 AGPVVAVDGVDLEIPAGRIVALLGASGSGKSSLLRAVAGLEPVAAGSIRWDGRDVVGTPV 79 Query: 74 RERNVAMVFQNYALYPHMSVYDNIAFGLRRLKRPAAEIDRRVREVAALLNLEALLERKPR 133 R ++FQ L+P V N+A+GL L P AE RRV E+ L+ L R Sbjct: 80 HRRGFGLMFQEGQLFPFRDVGGNVAYGLTGL--PRAERARRVAEMLELVGLPGYGPRPIT 137 Query: 134 AMSGGQQQRAAIARAIIKTPSVFLFDEPLSNLDAKLRAQLRGDIKRLHQRLRTTTVYVTH 193 +SGGQ QR A+ARA+ P + L DEPLS LD LR QL D++ + TT +YVTH Sbjct: 138 TLSGGQAQRVALARALAPRPRLLLLDEPLSALDRALREQLAVDLRAILAEQGTTALYVTH 197 Query: 194 DQLEAMTLADRVILMQDGRIVQAGSPAELYRYPRNLFAAGFIG 236 DQ EAMT+AD V +M+ GR+ + +PAEL+ P + A F+G Sbjct: 198 DQDEAMTVADEVGVMEAGRLARLAAPAELWADPGSASVAAFLG 240 Lambda K H 0.321 0.137 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 400 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 372 Length adjustment: 30 Effective length of query: 376 Effective length of database: 342 Effective search space: 128592 Effective search space used: 128592 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory