Align ABC-type sugar transport system, ATPase component protein (characterized, see rationale)
to candidate WP_017177778.1 A1QA_RS0104755 ABC transporter ATP-binding protein
Query= uniprot:D8IPI1 (406 letters) >NCBI__GCF_000295095.1:WP_017177778.1 Length = 386 Score = 234 bits (598), Expect = 2e-66 Identities = 118/233 (50%), Positives = 161/233 (69%), Gaps = 2/233 (0%) Query: 20 LHPLDLHIGDGEFVVLLGPSGCGKSTMLRMIAGLEDISGGTLRIGGTVVNDLPARERNVA 79 +H + L I GEFV LLGPSGCGK+T LRMIAG ED + G + + G + LP +R ++ Sbjct: 38 VHGVSLDIAPGEFVTLLGPSGCGKTTTLRMIAGFEDTTSGQVVLDGQNMVSLPPNKRPMS 97 Query: 80 MVFQNYALYPHMSVYDNIAFGLRRLKRPAAEIDRRVREVAALLNLEALLERKPRAMSGGQ 139 MVFQ+YAL+PH+SV +NIA+GL+ EI +V +NL +L +R P +SGGQ Sbjct: 98 MVFQSYALFPHLSVRENIAYGLKLRHTKPEEIREQVEIALTSMNLNSLADRAPNELSGGQ 157 Query: 140 QQRAAIARAIIKTPSVFLFDEPLSNLDAKLRAQLRGDIKRLHQRLRTTTVYVTHDQLEAM 199 QQR A+ARA++ P V LFDEPLSNLDAKLR ++R +I+RL QR+ T++YVTHDQ EAM Sbjct: 158 QQRVALARAMVMRPKVLLFDEPLSNLDAKLRVRMRLEIRRLQQRMGITSIYVTHDQAEAM 217 Query: 200 TLADRVILMQDGRIVQAGSPAELYRYPRNLFAAGFIGTPAMNFLSGTVQRQDG 252 T++DR+++M G I Q +P ++YR P ++F A FIG NFL+ T + G Sbjct: 218 TMSDRIVVMNAGTIEQVATPEKIYRRPASVFVADFIG--RANFLAATARDVGG 268 Lambda K H 0.321 0.137 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 414 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 386 Length adjustment: 31 Effective length of query: 375 Effective length of database: 355 Effective search space: 133125 Effective search space used: 133125 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory