Align D-lactate transporter, ATP-binding component (characterized)
to candidate WP_008861009.1 HMPREF9448_RS02500 ABC transporter ATP-binding protein
Query= reanno::Phaeo:GFF1248 (251 letters) >NCBI__GCF_000296465.1:WP_008861009.1 Length = 305 Score = 85.5 bits (210), Expect = 1e-21 Identities = 68/233 (29%), Positives = 107/233 (45%), Gaps = 18/233 (7%) Query: 4 LEVKNVGKRFGGLQALSDVNLSVRENTVHAIIGPNGAGKSTLLNCLVGKLIPDTGSVMFD 63 +E++ + KR+G L A+ ++ VR + +IGP+GAGK+TL L L PD G D Sbjct: 7 IEIRGLTKRYGSLTAIENITFEVRRGELFGLIGPDGAGKTTLFRLLATLLNPDDGVATVD 66 Query: 64 GKSVLGRAPYEINQMGISRVFQTPEIFGDLSVLENMMIPCFAKRDGAFEMNAISAVSGQR 123 G ++G+ Y+ + + + ++ DLSV EN+ FA G V Sbjct: 67 GFDIVGQ--YKEIRKRVGYMPGRFSLYPDLSVEENLEF--FAALFGV-------GVKDNY 115 Query: 124 DILEKAEHMLEEMNMADKRHMNAASMSRGDKRRLEIGMCLSQEPRLLLLDEPTAGMARAD 183 D++ +E R A +S G K++L + L P +L LDEPT G+ Sbjct: 116 DLIAPIYTQIEPF-----RKRRAGKLSGGMKQKLALCCALIHRPSVLFLDEPTTGVDAVS 170 Query: 184 TNNTIDLLKQIKSERDITIAIIEHDMHVVFSLADRITVLAQGTPLVEDDPQNI 236 + D+L ++KS + I+I + M DRI + G L D P I Sbjct: 171 RSEFWDMLSELKS-KGISILVSTPYMDEA-CRCDRIALCNNGKILGIDTPAGI 221 Lambda K H 0.318 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 185 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 251 Length of database: 305 Length adjustment: 25 Effective length of query: 226 Effective length of database: 280 Effective search space: 63280 Effective search space used: 63280 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory