GapMind for catabolism of small carbon sources

 

Protein WP_156804435.1 in Gallaecimonas xiamenensis 3-C-1

Annotation: NCBI__GCF_000299915.1:WP_156804435.1

Length: 375 amino acids

Source: GCF_000299915.1 in NCBI

Candidate for 114 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
putrescine catabolism potA hi PotG aka B0855, component of Putrescine porter (characterized) 64% 95% 427.9 Uncharacterized ABC transporter ATP-binding protein YdcT 42% 253.8
xylitol catabolism Dshi_0546 med ABC transporter for Xylitol, ATPase component (characterized) 42% 89% 248.1 PotG aka B0855, component of Putrescine porter 64% 427.9
D-maltose catabolism thuK med Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 40% 89% 233 PotG aka B0855, component of Putrescine porter 64% 427.9
trehalose catabolism thuK med Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 40% 89% 233 PotG aka B0855, component of Putrescine porter 64% 427.9
L-arabinose catabolism xacJ med Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale) 43% 76% 226.9 PotG aka B0855, component of Putrescine porter 64% 427.9
N-acetyl-D-glucosamine catabolism SMc02869 med N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 43% 80% 226.5 PotG aka B0855, component of Putrescine porter 64% 427.9
D-glucosamine (chitosamine) catabolism SMc02869 med N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 43% 80% 226.5 PotG aka B0855, component of Putrescine porter 64% 427.9
D-cellobiose catabolism msiK med MsiK protein, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized) 42% 76% 225.7 PotG aka B0855, component of Putrescine porter 64% 427.9
D-maltose catabolism malK_Bb med ABC-type maltose transport, ATP binding protein (characterized, see rationale) 46% 71% 223 PotG aka B0855, component of Putrescine porter 64% 427.9
D-sorbitol (glucitol) catabolism mtlK med ABC transporter for D-Sorbitol, ATPase component (characterized) 46% 72% 223 PotG aka B0855, component of Putrescine porter 64% 427.9
sucrose catabolism thuK med ThuK aka RB0314 aka SMB20328, component of Trehalose/maltose/sucrose porter (trehalose inducible) (characterized) 45% 72% 222.2 PotG aka B0855, component of Putrescine porter 64% 427.9
D-cellobiose catabolism SMc04256 med ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized) 41% 80% 215.7 PotG aka B0855, component of Putrescine porter 64% 427.9
D-cellobiose catabolism gtsD med ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 42% 75% 213 PotG aka B0855, component of Putrescine porter 64% 427.9
D-galactose catabolism PfGW456L13_1897 med ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 42% 75% 213 PotG aka B0855, component of Putrescine porter 64% 427.9
D-glucose catabolism gtsD med ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 42% 75% 213 PotG aka B0855, component of Putrescine porter 64% 427.9
lactose catabolism gtsD med ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 42% 75% 213 PotG aka B0855, component of Putrescine porter 64% 427.9
D-maltose catabolism gtsD med ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 42% 75% 213 PotG aka B0855, component of Putrescine porter 64% 427.9
sucrose catabolism gtsD med ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 42% 75% 213 PotG aka B0855, component of Putrescine porter 64% 427.9
trehalose catabolism gtsD med ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 42% 75% 213 PotG aka B0855, component of Putrescine porter 64% 427.9
trehalose catabolism treV med TreV, component of Trehalose porter (characterized) 43% 77% 207.6 PotG aka B0855, component of Putrescine porter 64% 427.9
L-histidine catabolism hutV med ABC transporter for L-Histidine, ATPase component (characterized) 42% 82% 174.5 PotG aka B0855, component of Putrescine porter 64% 427.9
L-proline catabolism hutV med HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized) 40% 83% 167.5 PotG aka B0855, component of Putrescine porter 64% 427.9
L-histidine catabolism Ac3H11_2560 med ABC transporter for L-Histidine, ATPase component (characterized) 44% 80% 167.2 PotG aka B0855, component of Putrescine porter 64% 427.9
D-mannitol catabolism mtlK lo SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter (characterized) 40% 87% 236.9 PotG aka B0855, component of Putrescine porter 64% 427.9
D-maltose catabolism malK lo Maltose-transporting ATPase (EC 3.6.3.19) (characterized) 38% 85% 235.7 PotG aka B0855, component of Putrescine porter 64% 427.9
lactose catabolism lacK lo ABC transporter for Lactose, ATPase component (characterized) 38% 97% 234.6 PotG aka B0855, component of Putrescine porter 64% 427.9
D-mannose catabolism TT_C0211 lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 39% 91% 231.5 PotG aka B0855, component of Putrescine porter 64% 427.9
D-maltose catabolism malK1 lo MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 39% 92% 230.3 PotG aka B0855, component of Putrescine porter 64% 427.9
D-cellobiose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 40% 86% 229.2 PotG aka B0855, component of Putrescine porter 64% 427.9
D-glucose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 40% 86% 229.2 PotG aka B0855, component of Putrescine porter 64% 427.9
lactose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 40% 86% 229.2 PotG aka B0855, component of Putrescine porter 64% 427.9
D-maltose catabolism aglK lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 40% 86% 229.2 PotG aka B0855, component of Putrescine porter 64% 427.9
D-maltose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 40% 86% 229.2 PotG aka B0855, component of Putrescine porter 64% 427.9
sucrose catabolism aglK lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 40% 86% 229.2 PotG aka B0855, component of Putrescine porter 64% 427.9
sucrose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 40% 86% 229.2 PotG aka B0855, component of Putrescine porter 64% 427.9
trehalose catabolism aglK lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 40% 86% 229.2 PotG aka B0855, component of Putrescine porter 64% 427.9
trehalose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 40% 86% 229.2 PotG aka B0855, component of Putrescine porter 64% 427.9
L-fucose catabolism SM_b21106 lo ABC transporter for L-Fucose, ATPase component (characterized) 38% 95% 225.3 PotG aka B0855, component of Putrescine porter 64% 427.9
L-arabinose catabolism xacK lo Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale) 38% 91% 223.8 PotG aka B0855, component of Putrescine porter 64% 427.9
D-maltose catabolism musK lo ABC-type maltose transporter (EC 7.5.2.1) (characterized) 39% 85% 221.5 PotG aka B0855, component of Putrescine porter 64% 427.9
D-maltose catabolism malK_Aa lo ABC-type maltose transporter (EC 7.5.2.1) (characterized) 38% 86% 216.9 PotG aka B0855, component of Putrescine porter 64% 427.9
D-xylose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 39% 83% 213 PotG aka B0855, component of Putrescine porter 64% 427.9
D-glucosamine (chitosamine) catabolism SM_b21216 lo ABC transporter for D-Glucosamine, ATPase component (characterized) 39% 79% 212.6 PotG aka B0855, component of Putrescine porter 64% 427.9
D-cellobiose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 36% 87% 211.1 PotG aka B0855, component of Putrescine porter 64% 427.9
D-galactose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 36% 87% 211.1 PotG aka B0855, component of Putrescine porter 64% 427.9
D-glucose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 36% 87% 211.1 PotG aka B0855, component of Putrescine porter 64% 427.9
lactose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 36% 87% 211.1 PotG aka B0855, component of Putrescine porter 64% 427.9
D-maltose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 36% 87% 211.1 PotG aka B0855, component of Putrescine porter 64% 427.9
D-mannose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 36% 87% 211.1 PotG aka B0855, component of Putrescine porter 64% 427.9
sucrose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 36% 87% 211.1 PotG aka B0855, component of Putrescine porter 64% 427.9
trehalose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 36% 87% 211.1 PotG aka B0855, component of Putrescine porter 64% 427.9
D-maltose catabolism malK_Sm lo MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 35% 96% 209.5 PotG aka B0855, component of Putrescine porter 64% 427.9
trehalose catabolism malK lo MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 35% 96% 209.5 PotG aka B0855, component of Putrescine porter 64% 427.9
xylitol catabolism HSERO_RS17020 lo ABC-type sugar transport system, ATPase component protein (characterized, see rationale) 43% 59% 196.4 PotG aka B0855, component of Putrescine porter 64% 427.9
L-arabinose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 35% 83% 188.3 PotG aka B0855, component of Putrescine porter 64% 427.9
D-fructose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 35% 83% 188.3 PotG aka B0855, component of Putrescine porter 64% 427.9
sucrose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 35% 83% 188.3 PotG aka B0855, component of Putrescine porter 64% 427.9
D-xylose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 35% 83% 188.3 PotG aka B0855, component of Putrescine porter 64% 427.9
L-proline catabolism proV lo Glycine betaine/proline betaine transport system ATP-binding protein ProV (characterized) 40% 69% 181.8 PotG aka B0855, component of Putrescine porter 64% 427.9
L-proline catabolism opuBA lo BusAA, component of Uptake system for glycine-betaine (high affinity) and proline (low affinity) (OpuAA-OpuABC) or BusAA-ABC of Lactococcus lactis). BusAA, the ATPase subunit, has a C-terminal tandem cystathionine β-synthase (CBS) domain which is the cytoplasmic K+ sensor for osmotic stress (osmotic strength)while the BusABC subunit has the membrane and receptor domains fused to each other (Biemans-Oldehinkel et al., 2006; Mahmood et al., 2006; Gul et al. 2012). An N-terminal amphipathic α-helix of OpuA is necessary for high activity but is not critical for biogenesis or the ionic regulation of transport (characterized) 38% 66% 180.3 PotG aka B0855, component of Putrescine porter 64% 427.9
L-histidine catabolism PA5503 lo Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN (characterized) 39% 74% 177.2 PotG aka B0855, component of Putrescine porter 64% 427.9
D-alanine catabolism Pf6N2E2_5405 lo ABC transporter for D-Alanine, ATPase component (characterized) 36% 96% 168.7 PotG aka B0855, component of Putrescine porter 64% 427.9
glycerol catabolism glpT lo GlpT, component of Glycerol uptake porter, GlpSTPQV (characterized) 35% 79% 168.3 PotG aka B0855, component of Putrescine porter 64% 427.9
L-asparagine catabolism bztD lo BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 35% 91% 166.4 PotG aka B0855, component of Putrescine porter 64% 427.9
L-aspartate catabolism bztD lo BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 35% 91% 166.4 PotG aka B0855, component of Putrescine porter 64% 427.9
L-glutamate catabolism gltL lo BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 35% 91% 166.4 PotG aka B0855, component of Putrescine porter 64% 427.9
L-asparagine catabolism bgtA lo ATPase (characterized, see rationale) 36% 95% 164.9 PotG aka B0855, component of Putrescine porter 64% 427.9
L-aspartate catabolism bgtA lo ATPase (characterized, see rationale) 36% 95% 164.9 PotG aka B0855, component of Putrescine porter 64% 427.9
L-arginine catabolism artP lo Arginine transport ATP-binding protein ArtM (characterized) 37% 100% 164.1 PotG aka B0855, component of Putrescine porter 64% 427.9
L-histidine catabolism aapP lo ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component (characterized) 35% 99% 163.7 PotG aka B0855, component of Putrescine porter 64% 427.9
D-glucosamine (chitosamine) catabolism AO353_21725 lo ABC transporter for D-Glucosamine, putative ATPase component (characterized) 36% 98% 162.2 PotG aka B0855, component of Putrescine porter 64% 427.9
glycerol catabolism glpS lo ABC transporter for Glycerol, ATPase component 1 (characterized) 32% 88% 162.2 PotG aka B0855, component of Putrescine porter 64% 427.9
L-asparagine catabolism glnQ lo Glutamine ABC transporter ATP-binding protein, component of Glutamine transporter, GlnQP. Takes up glutamine, asparagine and glutamate which compete for each other for binding both substrate and the transmembrane protein constituent of the system (Fulyani et al. 2015). Tandem substrate binding domains (SBDs) differ in substrate specificity and affinity, allowing cells to efficiently accumulate different amino acids via a single ABC transporter. Analysis revealed the roles of individual residues in determining the substrate affinity (characterized) 35% 96% 156.4 PotG aka B0855, component of Putrescine porter 64% 427.9
L-asparagine catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 33% 99% 156 PotG aka B0855, component of Putrescine porter 64% 427.9
L-aspartate catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 33% 99% 156 PotG aka B0855, component of Putrescine porter 64% 427.9
L-glutamate catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 33% 99% 156 PotG aka B0855, component of Putrescine porter 64% 427.9
L-leucine catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 33% 99% 156 PotG aka B0855, component of Putrescine porter 64% 427.9
L-proline catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 33% 99% 156 PotG aka B0855, component of Putrescine porter 64% 427.9
L-lysine catabolism hisP lo ABC transporter for L-Lysine, ATPase component (characterized) 35% 98% 154.1 PotG aka B0855, component of Putrescine porter 64% 427.9
L-asparagine catabolism aatP lo Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter (characterized) 34% 99% 153.3 PotG aka B0855, component of Putrescine porter 64% 427.9
L-aspartate catabolism aatP lo Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter (characterized) 34% 99% 153.3 PotG aka B0855, component of Putrescine porter 64% 427.9
L-histidine catabolism hisP lo Probable ATP-binding component of ABC transporter, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized) 33% 98% 151 PotG aka B0855, component of Putrescine porter 64% 427.9
L-histidine catabolism BPHYT_RS24015 lo ABC transporter related (characterized, see rationale) 33% 97% 145.2 PotG aka B0855, component of Putrescine porter 64% 427.9
L-histidine catabolism bgtA lo BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized) 34% 99% 144.8 PotG aka B0855, component of Putrescine porter 64% 427.9
L-asparagine catabolism peb1C lo PEB1C, component of Uptake system for glutamate and aspartate (characterized) 33% 99% 144.1 PotG aka B0855, component of Putrescine porter 64% 427.9
L-aspartate catabolism peb1C lo PEB1C, component of Uptake system for glutamate and aspartate (characterized) 33% 99% 144.1 PotG aka B0855, component of Putrescine porter 64% 427.9
L-citrulline catabolism PS417_17605 lo ATP-binding cassette domain-containing protein; SubName: Full=Amino acid transporter; SubName: Full=Histidine ABC transporter ATP-binding protein; SubName: Full=Histidine transport system ATP-binding protein (characterized, see rationale) 34% 94% 141.7 PotG aka B0855, component of Putrescine porter 64% 427.9
L-tryptophan catabolism ecfA1 lo Energy-coupling factor transporter ATP-binding protein EcfA1; Short=ECF transporter A component EcfA; EC 7.-.-.- (characterized, see rationale) 40% 74% 141 PotG aka B0855, component of Putrescine porter 64% 427.9
L-alanine catabolism braG lo High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 32% 97% 129 PotG aka B0855, component of Putrescine porter 64% 427.9
L-isoleucine catabolism livF lo High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 32% 97% 129 PotG aka B0855, component of Putrescine porter 64% 427.9
L-leucine catabolism livF lo High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 32% 97% 129 PotG aka B0855, component of Putrescine porter 64% 427.9
L-serine catabolism braG lo High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 32% 97% 129 PotG aka B0855, component of Putrescine porter 64% 427.9
L-threonine catabolism braG lo High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 32% 97% 129 PotG aka B0855, component of Putrescine porter 64% 427.9
L-valine catabolism livF lo High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 32% 97% 129 PotG aka B0855, component of Putrescine porter 64% 427.9
L-isoleucine catabolism livG lo ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized) 31% 99% 128.3 PotG aka B0855, component of Putrescine porter 64% 427.9
L-leucine catabolism livG lo ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized) 31% 99% 128.3 PotG aka B0855, component of Putrescine porter 64% 427.9
L-valine catabolism livG lo ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized) 31% 99% 128.3 PotG aka B0855, component of Putrescine porter 64% 427.9
L-phenylalanine catabolism livG lo High-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG (characterized, see rationale) 30% 95% 126.7 PotG aka B0855, component of Putrescine porter 64% 427.9
D-cellobiose catabolism cbtD lo CbtD, component of Cellobiose and cellooligosaccharide porter (characterized) 32% 81% 125.9 PotG aka B0855, component of Putrescine porter 64% 427.9
L-arabinose catabolism xylGsa lo Xylose/arabinose import ATP-binding protein XylG; EC 7.5.2.13 (characterized, see rationale) 33% 98% 124.8 PotG aka B0855, component of Putrescine porter 64% 427.9
L-phenylalanine catabolism livF lo High-affinity branched-chain amino acid transport ATP-binding protein (characterized, see rationale) 33% 97% 123.6 PotG aka B0855, component of Putrescine porter 64% 427.9
L-arginine catabolism braG lo ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale) 30% 96% 122.1 PotG aka B0855, component of Putrescine porter 64% 427.9
L-glutamate catabolism braG lo ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale) 30% 96% 122.1 PotG aka B0855, component of Putrescine porter 64% 427.9
L-histidine catabolism braG lo ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale) 30% 96% 122.1 PotG aka B0855, component of Putrescine porter 64% 427.9
L-tryptophan catabolism ecfA2 lo Energy-coupling factor transporter ATP-binding protein EcfA2; Short=ECF transporter A component EcfA2; EC 7.-.-.- (characterized, see rationale) 33% 77% 120.9 PotG aka B0855, component of Putrescine porter 64% 427.9
D-alanine catabolism AZOBR_RS08250 lo Leucine//isoleucine/valine ABC transporter,ATPase component; EC 3.6.3.- (characterized, see rationale) 32% 97% 119.4 PotG aka B0855, component of Putrescine porter 64% 427.9
L-proline catabolism AZOBR_RS08250 lo Leucine//isoleucine/valine ABC transporter,ATPase component; EC 3.6.3.- (characterized, see rationale) 32% 97% 119.4 PotG aka B0855, component of Putrescine porter 64% 427.9
D-cellobiose catabolism mglA lo glucose transporter, ATPase component (characterized) 34% 87% 119 PotG aka B0855, component of Putrescine porter 64% 427.9
D-glucose catabolism mglA lo glucose transporter, ATPase component (characterized) 34% 87% 119 PotG aka B0855, component of Putrescine porter 64% 427.9
lactose catabolism mglA lo glucose transporter, ATPase component (characterized) 34% 87% 119 PotG aka B0855, component of Putrescine porter 64% 427.9
D-maltose catabolism mglA lo glucose transporter, ATPase component (characterized) 34% 87% 119 PotG aka B0855, component of Putrescine porter 64% 427.9
sucrose catabolism mglA lo glucose transporter, ATPase component (characterized) 34% 87% 119 PotG aka B0855, component of Putrescine porter 64% 427.9
trehalose catabolism mglA lo glucose transporter, ATPase component (characterized) 34% 87% 119 PotG aka B0855, component of Putrescine porter 64% 427.9
citrate catabolism fecE lo iron(III) dicitrate transport ATP-binding protein FecE (characterized) 31% 95% 112.5 PotG aka B0855, component of Putrescine porter 64% 427.9

Sequence Analysis Tools

View WP_156804435.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MAMTGSEAPLATPPVLLTIEGVSKFFGQVKAVDNVSLEIRKGEIFALLGGSGSGKSTLLR
MLAGFEQPSSGRIFIDGQDITELPPYKRPINMMFQSYALFPHMTVAQNIAYGLKQDGLPK
AEIGPRVDEMLRLVRMTDYAQRKPQQLSGGQRQRVALARSLAKRPKLLLLDEPMGALDKK
LRTQMQLELVQIIESVGVTCVMVTHDQEEAMTMAQRIAIMNEGWIVQQGTPLDIYESPNS
RMTAEFIGSVNMFEGELVDDAPDHALIQVPGLEAPIFVSRGVTTAMEDPKVFVAVRPEKL
QVTFDAPEDTQYNWAQGKVHDIAYLGSHSVYYIRLASGQLIQSQYTNLERRGERPTWGDE
VYVSWEAASPMVLRS

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory