Align Periplasmic binding protein/LacI transcriptional regulator (characterized, see rationale)
to candidate WP_156804529.1 B3C1_RS10875 substrate-binding domain-containing protein
Query= uniprot:A0KWY4 (313 letters) >NCBI__GCF_000299915.1:WP_156804529.1 Length = 309 Score = 455 bits (1170), Expect = e-133 Identities = 231/307 (75%), Positives = 265/307 (86%), Gaps = 2/307 (0%) Query: 5 KIITALGLWAVSATCAYATTVGFSQVGSESGWRTSFSEAVKAEAKQRGIDLKFADAQQKQ 64 K + A GL A+S + A A TVGFSQVGSESGWR+SFS+ +K EAK RGIDLKFAD QQKQ Sbjct: 5 KTLFAAGLMALSHS-ALAITVGFSQVGSESGWRSSFSQDMKDEAKSRGIDLKFADGQQKQ 63 Query: 65 ENQIKAVRSFIAQGVDAIIIAPVVETGWKPVLKEAKRAKIPVVIVDRNIKVDDDSLFLTR 124 ENQI+AVRSFIAQGVDAIIIAPVVETGW PVLKEAKRA+IPVVI+DRNIK + L++TR Sbjct: 64 ENQIRAVRSFIAQGVDAIIIAPVVETGWTPVLKEAKRARIPVVILDRNIKAAE-GLYVTR 122 Query: 125 IASDFSEEGRKIGQWLMDKTQGNCDIAELQGTVGATAAIDRAAGFNQVIANYPNAKIVRS 184 IASDF+EEGRK +WLMDKT+G C+I ELQGTVGATAAIDRA GFN+VI YP AKIVRS Sbjct: 123 IASDFTEEGRKAARWLMDKTKGQCNIVELQGTVGATAAIDRAKGFNEVIGAYPQAKIVRS 182 Query: 185 QTGEFTRAKGKEVMEGFLKAQNGQPLCAVWSHNDEMALGAVQAIKEAGLKPGKDILIVSV 244 QT EFTRAKGKEVME FLKA++ Q LCA+WSHNDEMALGA+QAIKEAGLKPGKD+L+VSV Sbjct: 183 QTAEFTRAKGKEVMESFLKAEDPQSLCALWSHNDEMALGAIQAIKEAGLKPGKDLLVVSV 242 Query: 245 DGVPDYFKAMADGDVNATVELSPYLGGPAFDAIDAYLKGNKDQAKLISTTGDVFTQETAA 304 DGVPDYFKAMA+GD N TVEL+P+LG PA+ ++ L G+K KLISTTG+VF Q+TAA Sbjct: 243 DGVPDYFKAMAEGDANITVELNPHLGAPAYQVVEKVLAGDKGIPKLISTTGEVFGQDTAA 302 Query: 305 AEYEKRR 311 EY+KR+ Sbjct: 303 TEYQKRK 309 Lambda K H 0.316 0.131 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 390 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 313 Length of database: 309 Length adjustment: 27 Effective length of query: 286 Effective length of database: 282 Effective search space: 80652 Effective search space used: 80652 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory